Fructosamine-3-kinase-related Antibody - BSA Free Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
Synthetic peptides corresponding to FN3KRP(fructosamine-3-kinase-related protein) The peptide sequence was selected from the N terminal of FN3KRP.
Peptide sequence MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FN3KRP |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Fructosamine-3-kinase-related Antibody - BSA Free
Background
FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.FN3KRP and FN3K (MIM 608425) protect proteins from nonenzymatic glycation by phosphorylating the modified amino acid. This phosphorylation destabilizes the sugar-amine linkage and leads to spontaneous decomposition (Conner et al., 2004 [PubMed 15381090]).[supplied by OMIM].
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu
Applications: WB
Publications for Fructosamine-3-kinase-related Antibody (NBP1-56367) (0)
There are no publications for Fructosamine-3-kinase-related Antibody (NBP1-56367).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Fructosamine-3-kinase-related Antibody (NBP1-56367) (0)
There are no reviews for Fructosamine-3-kinase-related Antibody (NBP1-56367).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Fructosamine-3-kinase-related Antibody (NBP1-56367) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Fructosamine-3-kinase-related Products
Research Areas for Fructosamine-3-kinase-related Antibody (NBP1-56367)
Find related products by research area.
|
Blogs on Fructosamine-3-kinase-related