Home » Frizzled-5 » Frizzled-5 Antibodies » Frizzled-5 Antibody (6A3)

Frizzled-5 Antibody (6A3)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody (M01), clone 6A3.Lane 1: FZD5 transfected lysate(64.5 KDa).Lane 2: Non-transfected lysate.
Western Blot: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody (M01), clone 6A3.Lane 1: FZD5 transfected lysate(64.5 KDa).Lane 2: ...read more
Proximity Ligation Assay: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of protein-protein interactions between WNT5A and FZD5. HeLa cells were stained with anti-WNT5A rabbit purified polyclonal 1:1200 and ...read more
Immunoprecipitation: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of FZD5 transfected lysate using anti-FZD5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FZD5 MaxPab rabbit polyclonal ...read more
ELISA: Frizzled-5 Antibody (6A3) [H00007855-M01] - Detection limit for recombinant GST tagged FZD5 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IP, PLA, S-ELISA
Clone
6A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Frizzled-5 Antibody (6A3) Summary

Immunogen
FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR
Specificity
FZD5 - frizzled homolog 5 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FZD5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
  • Proximity Ligation Assay
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00007855-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Frizzled-5 Antibody (6A3)

  • C2orf31
  • chromosome 2 open reading frame 31
  • DKFZP434E2135
  • frizzled (Drosophila) homolog 5
  • frizzled homolog 5 (Drosophila)
  • Frizzled5
  • Frizzled-5
  • Frz-5
  • FZ-5
  • FZD5
  • fzE5
  • HFZ5
  • MGC129692
  • seven-transmembrane receptor frizzled-5
  • Wnt receptor

Background

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Activity of Wnt/beta-catenin pathway in the embryonic chick lung. Western blot analysis of active and total beta-catenin in stage b1, b2 and b3 lungs, and stage 24 limb (as positive control). Control loading was performed using beta-tubulin (55 kDa). Total and active beta-catenin correspond to 92 kDa. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112388), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
(4 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Wnt-5a
[Unconjugated]
645-WN
Wnt-5a [Unconjugated]
(2 Reviews)
(126 Publications)
Species: Hu, Mu
Frizzled-7
Antibody [Unconjugate
AF198
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse Frizzled‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF198) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Frizzled‑7 at approximately 65 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Frizzled‑7 was detected in immersion fixed frozen sections of embryonic mouse gastrointestinal tract (11 d.p.c.) using 15 µg/mL Goat Anti-Mouse Frizzled‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF198) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Publications)
Species: Mu
Applications: WB, IHC
LRP-6 Antibody
AF1505
Western blot shows lysates of 293T human embryonic kidney cell line either mock transfected or transfected with human LRP‑6. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human LRP‑6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1505) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for LRP‑6 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(4 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
Frizzled-9 Antibody
NLS5103
Immunohistochemistry-Paraffin: Frizzled-9 Antibody [NLS5103] - Anti-FZD9 / Frizzled 9 antibody IHC of human Brain, Glioblastoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: Frizzled-9 Antibody [NLS5103] - Analysis of anti-FZD9 / Frizzled 9 antibody with brain, Purkinje neurons at 13 ug/ ml.
Immunohistochemistry-Paraffin: Frizzled-9 Antibody [NLS5103] - Analysis of anti-FZD9 / Frizzled 9 antibody with human brain, glioblastoma.
Species: Hu, Bv, Ca
Applications: IHC, IHC-P, ICC
Frizzled-1
Antibody (162531) [Un ...
MAB11201
HEK293 human embryonic kidney cell line transfected with Frizzled-1 was stained with Rat Anti-Human/Mouse Frizzled-1 Monoclonal Antibody (Catalog # MAB11201, filled histogram) or isotype control antibody (Catalog # MAB006, open histogram) followed by anti-Rat IgG APC-conjugated secondary antibody (Catalog # F0113). View our protocol for Staining Membrane-associated Proteins.
HEK293 human embryonic kidney cell line was stained with Rat Anti-Human/Mouse Frizzled-1 Monoclonal Antibody (Catalog # MAB11201, filled histogram) or isotype control antibody (Catalog # MAB006, open histogram) followed by anti-Rat IgG APC-conjugated secondary antibody (Catalog # F0113). View our protocol for Staining Membrane-associated Proteins.
(1 Publication)
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
LRP-5 Antibody
AF6646
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Human LRP-5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6646) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for LRP-5 at approximately 185 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Frizzled-4
Antibody (145901)
MAB194
Frizzled-4 Antibody (145901)
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Frizzled-2 Antibody
NBP1-20920
Western Blot: Frizzled-2 Antibody [NBP1-20920] - (0.03ug/ml) staining of Human Heart (A) and (0.1ug/ml) Placenta (B) lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Frizzled-2 Antibody [NBP1-20920] - Analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear and cytoplasmic staining. Actin filaments were stained with phalloidin (red). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
Immunohistochemistry-Paraffin: Frizzled-2 Antibody [NBP1-20920] - Staining of paraffin embedded human thyroid Gland. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Wnt-3a
[Unconjugated]
5036-WN
Recombinant Human Wnt-3a (Catalog # 5036-WN) induces alkaline phosphatase production by the MC3T3-E1 mouse preosteoblast cell line. The ED50 is 1.7-fold better with more than twice the maximum response compared to the top competitor's Wnt-3a.
(17 Reviews)
(216 Publications)
Species: Hu
Wnt-1 Antibody
(10C8)
NBP1-51575
Western Blot: Wnt-1 Antibody (10C8) [NBP1-51575] - Analysis using WNT1 mouse mAb against NIH/3T3 (1), 3T3L1 (2) and Hela (3) cell lysate.
Immunocytochemistry/Immunofluorescence: Wnt-1 Antibody (10C8) [NBP1-51575] - Confocal immunofluorescence analysis of Hela (left) and 3T3-L1 (right) cells using WNT1 mouse mAb (green). Red: Actin filaments have been labeled with DY-554 phalloidin. Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: Wnt-1 Antibody (10C8) [NBP1-51575] - Analysis of human LAdrenal tissues using WNT1 mouse mAb.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Frizzled-10
Antibody
NBP2-23659
Western Blot: Frizzled-10 Antibody [NBP2-23659] - Analysis of Frizzled-10 in human brain lysate. Lane 1 shows pre-immune sera and Lanes 2 show NBP2-23659 tested on human at 1:1000 dilution.
Species: Hu, Mu, Pm
Applications: WB
Dkk-1
[Unconjugated]
5439-DK/CF
1 μg/lane of Recombinant Human Dkk-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing major bands at 33-38 kDa. Multiple bands in gel are due to variable glycosylation.
Recombinant Human Wnt‑3a (Catalog # 5036-WN) induces a dose responsive increase in Wnt reporter activity in HEK293 cells (green circles). Recombinant Human Dkk-1 (Catalog #5439‑DK/CF) inhibits a constant dose of 500 ng/mL of Recombinant Human Wnt-3a. The ED50 for this effect is 10‑60 ng/mL (orange circles).
(62 Publications)
Species: Hu
Frizzled-3
Antibody [Unconjugate
AF1001
Frizzled‑3 was detected in immersion fixed frozen sections of mouse embryo (E11) using Mouse Frizzled‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1001) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Publications)
Species: Mu
Applications: IHC
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in human cell lines Caco-2 and PC-3 using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Frozen: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Frozen 8 um rat liver tissue section fixed in formalin. HNF-4 alpha antibody at 1:100 (green). Multiplexed with a myeloperoxidase antibody (red). DAPI staining in blue. IHC-Fr image submitted by a verified customer review.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Wnt3 Antibody
(OTI1G7)
NBP2-46367
Western Blot: Wnt3 Antibody (1G7) [NBP2-46367] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY WNT3.
Immunohistochemistry: Wnt3 Antibody (1G7) [NBP2-46367] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Wnt3 Antibody (1G7) [NBP2-46367] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: WB, IHC
Axin-1 Antibody
AF3287
Western blot shows lysates of Raji human Burkitt's lymphoma cell line, Balb/3T3 mouse embryonic fibroblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Human/Mouse/Rat Axin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3287) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Axin-1 at approximately 120 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB
Frizzled-8
6129-FZ
Frizzled-8
(3 Publications)
Species: Hu

Publications for Frizzled-5 Antibody (H00007855-M01)(1)


Reviews for Frizzled-5 Antibody (H00007855-M01) (0)

There are no reviews for Frizzled-5 Antibody (H00007855-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Frizzled-5 Antibody (H00007855-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Frizzled-5 Products

Bioinformatics Tool for Frizzled-5 Antibody (H00007855-M01)

Discover related pathways, diseases and genes to Frizzled-5 Antibody (H00007855-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-5 Antibody (H00007855-M01)

Discover more about diseases related to Frizzled-5 Antibody (H00007855-M01).
 

Pathways for Frizzled-5 Antibody (H00007855-M01)

View related products by pathway.

PTMs for Frizzled-5 Antibody (H00007855-M01)

Learn more about PTMs related to Frizzled-5 Antibody (H00007855-M01).
 

Research Areas for Frizzled-5 Antibody (H00007855-M01)

Find related products by research area.

Blogs on Frizzled-5

There are no specific blogs for Frizzled-5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frizzled-5 Antibody (6A3) and receive a gift card or discount.


Bioinformatics

Gene Symbol FZD5
Entrez
OMIM
Uniprot