Frizzled-5 Antibody (6A3)

Images

 
Western Blot: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody (M01), clone 6A3.Lane 1: FZD5 transfected lysate(64.5 KDa).Lane 2: ...read more
Proximity Ligation Assay: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of protein-protein interactions between WNT5A and FZD5. HeLa cells were stained with anti-WNT5A rabbit purified polyclonal 1:1200 and ...read more
Immunoprecipitation: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of FZD5 transfected lysate using anti-FZD5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FZD5 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: Frizzled-5 Antibody (6A3) [H00007855-M01] - Detection limit for recombinant GST tagged FZD5 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, PLA
Clone
6A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Frizzled-5 Antibody (6A3) Summary

Immunogen
FZD5 (ENSP00000354607 72 a.a. - 161 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR
Specificity
FZD5 - frizzled homolog 5 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FZD5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00007855-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Frizzled-5 Antibody (6A3)

  • C2orf31
  • chromosome 2 open reading frame 31
  • DKFZP434E2135
  • frizzled (Drosophila) homolog 5
  • frizzled homolog 5 (Drosophila)
  • Frizzled5
  • Frizzled-5
  • Frz-5
  • FZ-5
  • FZD5
  • fzE5
  • HFZ5
  • MGC129692
  • seven-transmembrane receptor frizzled-5
  • Wnt receptor

Background

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
645-WN/CF
Species: Hu, Mu
AF198
Species: Mu
Applications: WB, IHC
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
AF1120
Species: Mu
Applications: WB, IHC
AF6646
Species: Hu
Applications: WB
AF194
Species: Mu
Applications: WB, IHC
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-23659
Species: Hu, Mu, Pm
Applications: WB
AF1001
Species: Mu
Applications: IHC
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
112-FZ
Species: Mu

Publications for Frizzled-5 Antibody (H00007855-M01)(1)

Reviews for Frizzled-5 Antibody (H00007855-M01) (0)

There are no reviews for Frizzled-5 Antibody (H00007855-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Frizzled-5 Antibody (H00007855-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Frizzled-5 Antibody (H00007855-M01)

Discover related pathways, diseases and genes to Frizzled-5 Antibody (H00007855-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-5 Antibody (H00007855-M01)

Discover more about diseases related to Frizzled-5 Antibody (H00007855-M01).
 

Pathways for Frizzled-5 Antibody (H00007855-M01)

View related products by pathway.

PTMs for Frizzled-5 Antibody (H00007855-M01)

Learn more about PTMs related to Frizzled-5 Antibody (H00007855-M01).
 

Research Areas for Frizzled-5 Antibody (H00007855-M01)

Find related products by research area.

Blogs on Frizzled-5

There are no specific blogs for Frizzled-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frizzled-5 Antibody (6A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol FZD5
Entrez
OMIM
Uniprot