Home » Frizzled-5 » Frizzled-5 Antibodies » Frizzled-5 Antibody (6A3)

Frizzled-5 Antibody (6A3)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody (M01), clone 6A3.Lane 1: FZD5 transfected lysate(64.5 KDa).Lane 2: Non-transfected lysate.
Western Blot: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody (M01), clone 6A3.Lane 1: FZD5 transfected lysate(64.5 KDa).Lane 2: ...read more
Proximity Ligation Assay: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of protein-protein interactions between WNT5A and FZD5. HeLa cells were stained with anti-WNT5A rabbit purified polyclonal 1:1200 and ...read more
Immunoprecipitation: Frizzled-5 Antibody (6A3) [H00007855-M01] - Analysis of FZD5 transfected lysate using anti-FZD5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FZD5 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: Frizzled-5 Antibody (6A3) [H00007855-M01] - Detection limit for recombinant GST tagged FZD5 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, PLA
Clone
6A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Frizzled-5 Antibody (6A3) Summary

Immunogen
FZD5 (ENSP00000354607 72 a.a. - 161 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR
Specificity
FZD5 - frizzled homolog 5 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FZD5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00007855-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Frizzled-5 Antibody (6A3)

  • C2orf31
  • chromosome 2 open reading frame 31
  • DKFZP434E2135
  • frizzled (Drosophila) homolog 5
  • frizzled homolog 5 (Drosophila)
  • Frizzled5
  • Frizzled-5
  • Frz-5
  • FZ-5
  • FZD5
  • fzE5
  • HFZ5
  • MGC129692
  • seven-transmembrane receptor frizzled-5
  • Wnt receptor

Background

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - Beta-catening (green) was detected in human skin (psoriasis) using beta-catenin-FITC antibody (1:40) in PBS for 1 hour. Nuclei were stained with Dapi (blue). Image from verified customer review.
(3 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
Wnt-5a
645-WN/CF
Wnt-5a
(103 Publications)
Species: Hu, Mu
Frizzled-7
Antibody [Unconjugate
AF198
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse Frizzled‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF198) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Frizzled‑7 at approximately 65 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Frizzled‑7 was detected in immersion fixed frozen sections of embryonic mouse gastrointestinal tract (11 d.p.c.) using 15 µg/mL Goat Anti-Mouse Frizzled‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF198) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Publications)
Species: Mu
Applications: WB, IHC
LRP-6 Antibody
AF1505
Western blot shows lysates of 293T human embryonic kidney cell line either mock transfected or transfected with human LRP‑6. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human LRP‑6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1505) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for LRP‑6 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
Frizzled-9 Antibody
NLS5103
Immunohistochemistry-Paraffin: Frizzled-9 Antibody [NLS5103] - Anti-FZD9 / Frizzled 9 antibody IHC of human Brain, Glioblastoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: Frizzled-9 Antibody [NLS5103] - Analysis of anti-FZD9 / Frizzled 9 antibody with brain, Purkinje neurons at 13 ug/ ml.
Immunohistochemistry-Paraffin: Frizzled-9 Antibody [NLS5103] - Analysis of anti-FZD9 / Frizzled 9 antibody with human brain, glioblastoma.
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
Frizzled-1 Antibody
AF1120
Frizzled‑1 was detected in immersion fixed frozen sections of embryonic mouse intestine (13 d.p.c.) using 15 µg/mL Goat Anti-Mouse Frizzled‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1120) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the plasma membrane of epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(3 Publications)
Species: Mu
Applications: WB, IHC
LRP-5 Antibody
AF6646
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Human LRP-5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6646) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for LRP-5 at approximately 185 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Frizzled-4 Antibody
AF194
Frizzled‑4 was detected in immersion fixed frozen sections of embryonic mouse neuronal tissue (E11) using 15 µg/mL Goat Anti-Mouse Frizzled‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF194) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the plasma membrane and cytoplasm of neuronal cells in the midbrain. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(3 Publications)
Species: Mu
Applications: WB, IHC
Frizzled-2 Antibody
NBP2-33842
Immunocytochemistry/Immunofluorescence: Frizzled-2 Antibody [NBP2-33842] - Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear bodies & cell junctions.
Immunohistochemistry-Paraffin: Frizzled-2 Antibody [NBP2-33842] - Staining of human testis shows weak to moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Frizzled-2 Antibody [NBP2-33842] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Wnt-3a
[Unconjugated]
5036-WN
Wnt-3a [Unconjugated]
(13 Reviews)
(161 Publications)
Species: Hu
Wnt-1 Antibody
(10C8)
NBP1-51575
Western Blot: Wnt-1 Antibody (10C8) [NBP1-51575] - Western blot analysis using WNT1 mouse mAb against NIH/3T3 (1), 3T3L1 (2) and Hela (3) cell lysate.
Immunocytochemistry/Immunofluorescence: Wnt-1 Antibody (10C8) [NBP1-51575] - Confocal immunofluorescence analysis of Hela (left) and 3T3-L1 (right) cells using WNT1 mouse mAb (green). Red: Actin filaments have been labeled with DY-554 phalloidin. Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: Wnt-1 Antibody (10C8) [NBP1-51575] - Immunohistochemical analysis of paraffin-embedded human LAdrenal tissues using WNT1 mouse mAb
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Frizzled-10
Antibody
NBP2-23659
Western Blot: Frizzled-10 Antibody [NBP2-23659] - Analysis of Frizzled-10 in human brain lysate. Lane 1 shows pre-immune sera and Lanes 2 show NBP2-23659 tested on human at 1:1000 dilution.
Species: Hu, Mu, Pm
Applications: WB
Dkk-1
[Unconjugated]
5439-DK/CF
Recombinant Human Wnt‑3a (Catalog # 5036-WN) induces a dose responsive increase in Wnt reporter activity in HEK293 cells (green circles). Recombinant Human Dkk-1 (Catalog #5439‑DK/CF) inhibits a constant dose of 500 ng/mL of Recombinant Human Wnt-3a. The ED50 for this effect is 10‑60 ng/mL (orange circles).
1 μg/lane of Recombinant Human Dkk-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing major bands at 33-38 kDa. Multiple bands in gel are due to variable glycosylation.
(51 Publications)
Species: Hu
Frizzled-3
Antibody [Unconjugate
AF1001
Frizzled‑3 was detected in immersion fixed frozen sections of mouse embryo (E11) using Mouse Frizzled‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1001) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Publications)
Species: Mu
Applications: IHC
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in control (vector only transfected HEK293T lysate) and HNF4A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining in human duodenum and tonsil tissues using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
Wnt3 Protein
H00007473-P01
SDS-Page: Recombinant Human Wnt3 Protein [H00007473-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
(5 Publications)
Species: Hu
Axin-1 Antibody
AF3287
Western blot shows lysates of Raji human Burkitt's lymphoma cell line, Balb/3T3 mouse embryonic fibroblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Human/Mouse/Rat Axin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3287) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Axin-1 at approximately 120 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB
Frizzled-8
112-FZ
Frizzled-8
(3 Publications)
Species: Mu

Publications for Frizzled-5 Antibody (H00007855-M01)(1)


Reviews for Frizzled-5 Antibody (H00007855-M01) (0)

There are no reviews for Frizzled-5 Antibody (H00007855-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Frizzled-5 Antibody (H00007855-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Frizzled-5 Antibody (H00007855-M01)

Discover related pathways, diseases and genes to Frizzled-5 Antibody (H00007855-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-5 Antibody (H00007855-M01)

Discover more about diseases related to Frizzled-5 Antibody (H00007855-M01).
 

Pathways for Frizzled-5 Antibody (H00007855-M01)

View related products by pathway.

PTMs for Frizzled-5 Antibody (H00007855-M01)

Learn more about PTMs related to Frizzled-5 Antibody (H00007855-M01).
 

Research Areas for Frizzled-5 Antibody (H00007855-M01)

Find related products by research area.

Blogs on Frizzled-5

There are no specific blogs for Frizzled-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frizzled-5 Antibody (6A3) and receive a gift card or discount.


Bioinformatics

Gene Symbol FZD5
Entrez
OMIM
Uniprot