Recombinant Human Frataxin Protein

Images

 
SDS-Page: Recombinant Human Frataxin Protein [H00002395-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Frataxin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-210 of Human FXN full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FXN
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Frataxin Protein

  • CyaY
  • EC 1.16.3.1
  • FA
  • FARRmitochondrial
  • frataxin
  • Friedreich ataxia protein
  • Friedreich ataxia
  • Fxn
  • X25MGC57199

Background

This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-15447
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-07799
Species: Hu
NBL1-11664
Species: Hu
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Frataxin Recombinant Protein (H00002395-P01) (0)

There are no publications for Frataxin Recombinant Protein (H00002395-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frataxin Recombinant Protein (H00002395-P01) (0)

There are no reviews for Frataxin Recombinant Protein (H00002395-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Frataxin Recombinant Protein (H00002395-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Frataxin Products

Bioinformatics Tool for Frataxin Recombinant Protein (H00002395-P01)

Discover related pathways, diseases and genes to Frataxin Recombinant Protein (H00002395-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frataxin Recombinant Protein (H00002395-P01)

Discover more about diseases related to Frataxin Recombinant Protein (H00002395-P01).
 

Pathways for Frataxin Recombinant Protein (H00002395-P01)

View related products by pathway.

PTMs for Frataxin Recombinant Protein (H00002395-P01)

Learn more about PTMs related to Frataxin Recombinant Protein (H00002395-P01).
 

Research Areas for Frataxin Recombinant Protein (H00002395-P01)

Find related products by research area.

Blogs on Frataxin

There are no specific blogs for Frataxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Frataxin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FXN