FPR1 Recombinant Protein Antigen

Images

 
There are currently no images for FPR1 Recombinant Protein Antigen (NBP2-47452PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FPR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FPR1.

Source: E. coli

Amino Acid Sequence: TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FPR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47452.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FPR1 Recombinant Protein Antigen

  • fMet-Leu-Phe receptor
  • fMLF-R
  • fMLP receptor
  • FMLP
  • formyl peptide receptor 1
  • FPR1
  • FPRfMet-Leu-Phe receptor
  • N-formyl peptide receptor
  • N-formylpeptide chemoattractant receptor

Background

Official Gene Symbol: FPR1 Gen Bank Accession Number: NP_002020 Gene ID: 2357 (Human) Gene Map Locus: 19q13.4 (Human) FPR1 is a member of chemoattractant/chemokine GPCRs expressed mainly on leukocytes, neutrophils and monocytes. FPR1 is a seven transmembrane pertussis toxin-sensitive GPCR and binds to formylated peptides generated by bacteria resulting in leukocyte trafficking to the site of inflammation. Ligand binding to FPR results in activation of multiple effectors including phospholipase C leading to calcium mobilization and PKC activation. Other implications of FPR signaling include polarization of actin cytoskeletion, activation of various integrins, increased cell migration, phagocytosis, degranulation and release of reactive oxygen intermediates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3648
Species: Hu
Applications: CyTOF-ready, Flow, Neut
NLS1878
Species: Ba, Hu, Mu, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
7954-GM/CF
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7954-GM/CF
Species: Hu
Applications: BA
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-47452PEP
Species: Hu
Applications: AC

Publications for FPR1 Recombinant Protein Antigen (NBP2-47452PEP) (0)

There are no publications for FPR1 Recombinant Protein Antigen (NBP2-47452PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FPR1 Recombinant Protein Antigen (NBP2-47452PEP) (0)

There are no reviews for FPR1 Recombinant Protein Antigen (NBP2-47452PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FPR1 Recombinant Protein Antigen (NBP2-47452PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FPR1 Products

Research Areas for FPR1 Recombinant Protein Antigen (NBP2-47452PEP)

Find related products by research area.

Blogs on FPR1

There are no specific blogs for FPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FPR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FPR1