Recombinant Human FOXO3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FOXO3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human FOXO3A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS

Protein/Peptide Type
Partial Recombinant Protein
Gene
FOXO3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FOXO3 Protein

  • AF6q21 protein
  • AF6q21
  • DKFZp781A0677
  • FKHRL1
  • FKHRL1MGC31925
  • FKHRL1P2
  • forkhead box O3
  • forkhead box protein O3
  • forkhead homolog (rhabdomyosarcoma) like 1
  • Forkhead in rhabdomyosarcoma-like 1
  • forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1
  • FOXO2
  • FoxO3
  • FOXO3A
  • FOXO3Aforkhead box O3A
  • MGC12739

Background

FOXO3A - forkhead box O3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45712
Species: Hu
Applications: WB, IHC
AF1555
Species: Hu
Applications: WB
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FOXO3 Partial Recombinant Protein (H00002309-Q01) (0)

There are no publications for FOXO3 Partial Recombinant Protein (H00002309-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXO3 Partial Recombinant Protein (H00002309-Q01) (0)

There are no reviews for FOXO3 Partial Recombinant Protein (H00002309-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXO3 Partial Recombinant Protein (H00002309-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FOXO3 Products

Bioinformatics Tool for FOXO3 Partial Recombinant Protein (H00002309-Q01)

Discover related pathways, diseases and genes to FOXO3 Partial Recombinant Protein (H00002309-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXO3 Partial Recombinant Protein (H00002309-Q01)

Discover more about diseases related to FOXO3 Partial Recombinant Protein (H00002309-Q01).
 

Pathways for FOXO3 Partial Recombinant Protein (H00002309-Q01)

View related products by pathway.

PTMs for FOXO3 Partial Recombinant Protein (H00002309-Q01)

Learn more about PTMs related to FOXO3 Partial Recombinant Protein (H00002309-Q01).
 

Research Areas for FOXO3 Partial Recombinant Protein (H00002309-Q01)

Find related products by research area.

Blogs on FOXO3

There are no specific blogs for FOXO3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FOXO3 Antibody
NBP2-16521

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FOXO3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXO3
Entrez