FoxM1 Antibody (2E2)

Immunocytochemistry/Immunofluorescence: FoxM1 Antibody (2E2) [H00002305-M07] - Analysis of monoclonal antibody to FOXM1 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: FoxM1 Antibody (2E2) [H00002305-M07] - Detection limit for recombinant GST tagged FOXM1 is 0.3 ng/ml as a capture antibody.

Product Discontinued

FoxM1 Antibody (2E2) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FOXM1 (NP_973731, 22 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS
• Marker: Mitosis Marker
• Specificity: FOXM1 (2E2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FOXM1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxM1 Antibody (2E2)

• FKHL16
• FKHL16trident
• forkhead box M1
• forkhead box protein M1
• Forkhead, drosophila, homolog-like 16
• forkhead-like 16
• Forkhead-related protein FKHL16
• FoxM1
• Hepatocyte nuclear factor 3 forkhead homolog 11
• HFH-11
• HFH11FOXM1B
• HFH-11M-phase phosphoprotein 2
• HNF-3
• HNF-3/fork-head homolog 11
• INS-1
• MPHOSPH2
• MPP-2
• MPP2MPM-2 reactive phosphoprotein 2
• PIG29
• TGT3
• Transcription factor Trident
• Trident
• WIN
• Winged-helix factor from INS-1 cells

Background

Transcriptional activatory factor. May play a role in the control of cell proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FoxM1 Antibody (H00002305-M07)(1)

Publication using H00002305-M07

• Alvandi Z, Nagata Y, Passos LSA et al. Wnt Site Signaling Inhibitor Secreted Frizzled-Related Protein 3 Protects Mitral Valve Endothelium From Myocardial Infarction-Induced Endothelial-to-Mesenchymal Transition Journal of the American Heart Association 2022-04-05 [PMID: 35348006] (IHC-Fr, Mouse)
  
  Details:
  1:300 IHC-Fr dilution

Bioinformatics

• Gene Symbol: FOXM1
• Entrez:
  • 2305(Human)
• OMIM:
  • 602341(Human)
• Uniprot:
  • NP_973731(Human)