FoxM1 Antibody (2E2.)

Images

 
Immunocytochemistry/ Immunofluorescence: FoxM1 Antibody (2E2) [H00002305-M07] - Analysis of monoclonal antibody to FOXM1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: FoxM1 Antibody (2E2) [H00002305-M07] - Detection limit for recombinant GST tagged FOXM1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FoxM1 Antibody (2E2.) Summary

Immunogen
FOXM1 (NP_973731, 22 a.a. - 110 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS
Marker
Mitosis Marker
Specificity
FOXM1 (2E2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxM1 Antibody (2E2.)

  • FKHL16
  • FKHL16trident
  • forkhead box M1
  • forkhead box protein M1
  • Forkhead, drosophila, homolog-like 16
  • forkhead-like 16
  • Forkhead-related protein FKHL16
  • FoxM1
  • Hepatocyte nuclear factor 3 forkhead homolog 11
  • HFH-11
  • HFH11FOXM1B
  • HFH-11M-phase phosphoprotein 2
  • HNF-3
  • HNF-3/fork-head homolog 11
  • INS-1
  • MPHOSPH2
  • MPP-2
  • MPP2MPM-2 reactive phosphoprotein 2
  • PIG29
  • TGT3
  • Transcription factor Trident
  • Trident
  • WIN
  • Winged-helix factor from INS-1 cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2400
Species: Hu
Applications: WB, ChIP, ICC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB300-546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for FoxM1 Antibody (H00002305-M07) (0)

There are no publications for FoxM1 Antibody (H00002305-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxM1 Antibody (H00002305-M07) (0)

There are no reviews for FoxM1 Antibody (H00002305-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FoxM1 Antibody (H00002305-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxM1 Products

Bioinformatics Tool for FoxM1 Antibody (H00002305-M07)

Discover related pathways, diseases and genes to FoxM1 Antibody (H00002305-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxM1 Antibody (H00002305-M07)

Discover more about diseases related to FoxM1 Antibody (H00002305-M07).
 

Pathways for FoxM1 Antibody (H00002305-M07)

View related products by pathway.

PTMs for FoxM1 Antibody (H00002305-M07)

Learn more about PTMs related to FoxM1 Antibody (H00002305-M07).
 

Research Areas for FoxM1 Antibody (H00002305-M07)

Find related products by research area.

Blogs on FoxM1

There are no specific blogs for FoxM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxM1 Antibody (2E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXM1
Entrez
OMIM
Uniprot