FoxJ3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FoxJ3 Antibody [NBP2-57077] - Staining of human cell line U-2 OS shows localization to nuclear speckles & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FoxJ3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXJ3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FoxJ3 Recombinant Protein Antigen (NBP2-57077PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FoxJ3 Antibody

  • forkhead box J3
  • forkhead box protein J3
  • FoxJ3
  • KIAA1041
  • MGC165036
  • MGC176686

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-88147
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00139628-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83897
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6366
Species: Hu
Applications: WB, IHC
H00387054-R01
Species: Hu
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00283150-Q01
Species: Hu
NBP2-41158
Species: Hu, Mu
Applications: WB, ELISA
NBP1-83153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45712
Species: Hu
Applications: WB, IHC
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1270
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-57077
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for FoxJ3 Antibody (NBP2-57077) (0)

There are no publications for FoxJ3 Antibody (NBP2-57077).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxJ3 Antibody (NBP2-57077) (0)

There are no reviews for FoxJ3 Antibody (NBP2-57077). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FoxJ3 Antibody (NBP2-57077) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxJ3 Products

Bioinformatics Tool for FoxJ3 Antibody (NBP2-57077)

Discover related pathways, diseases and genes to FoxJ3 Antibody (NBP2-57077). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxJ3 Antibody (NBP2-57077)

Discover more about diseases related to FoxJ3 Antibody (NBP2-57077).
 

Pathways for FoxJ3 Antibody (NBP2-57077)

View related products by pathway.

Blogs on FoxJ3

There are no specific blogs for FoxJ3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxJ3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXJ3
Entrez