Recombinant Human FOXD2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FOXD2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 411-494 of Human FOXD2

Source: Wheat Germ

Amino Acid Sequence: SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FOXD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
34.98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FOXD2 Protein

  • FKHL17forkhead, drosophila, homolog-like 17
  • forkhead box D2
  • forkhead-like 17
  • forkhead-related activator 9
  • Forkhead-related protein FKHL17
  • Forkhead-related transcription factor 9
  • FREAC-9
  • FREAC9forkhead box protein D2

Background

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30959
Species: Hu
Applications: WB
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00200350-Q01
Species: Hu
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, Flow, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00139628-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB7295
Species: Mu
Applications: IHC
NBP1-87928
Species: Hu
Applications: IHC, IHC-P
H00002301-R01
Species: Hu
H00002298-P01
Species: Hu
AF4798
Species: Hu, Mu
Applications: WB
H00002295-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00002306-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for FOXD2 Partial Recombinant Protein (H00002306-Q01) (0)

There are no publications for FOXD2 Partial Recombinant Protein (H00002306-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXD2 Partial Recombinant Protein (H00002306-Q01) (0)

There are no reviews for FOXD2 Partial Recombinant Protein (H00002306-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXD2 Partial Recombinant Protein (H00002306-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FOXD2 Products

Bioinformatics Tool for FOXD2 Partial Recombinant Protein (H00002306-Q01)

Discover related pathways, diseases and genes to FOXD2 Partial Recombinant Protein (H00002306-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXD2 Partial Recombinant Protein (H00002306-Q01)

Discover more about diseases related to FOXD2 Partial Recombinant Protein (H00002306-Q01).
 

Pathways for FOXD2 Partial Recombinant Protein (H00002306-Q01)

View related products by pathway.

PTMs for FOXD2 Partial Recombinant Protein (H00002306-Q01)

Learn more about PTMs related to FOXD2 Partial Recombinant Protein (H00002306-Q01).

Blogs on FOXD2

There are no specific blogs for FOXD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FoxP3 Antibody
NB100-39002
FOXD2 Antibody
NB100-1270
FOXO3 Antibody
NBP2-16521

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FOXD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXD2