FOLR1 Antibody

Images

 
Western Blot: FOLR1 Antibody [H00002348-D01P] - Analysis of FOLR1 expression in transfected 293T cell line by FOLR1 polyclonal antibody.Lane 1: FOLR1 transfected lysate(29.80 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: FOLR1 Antibody [H00002348-D01P] - Analysis of antibody to FOLR1 on HeLa cell. Antibody concentration 20 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FOLR1 Antibody Summary

Immunogen
FOLR1 (NP_000793.1, 1 a.a. - 257 a.a.) full-length human protein. MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOLR1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOLR1 Antibody

  • Adult folate-binding protein
  • FBP
  • folate binding protein
  • folate receptor 1 (adult)
  • Folate receptor 1
  • folate receptor alpha
  • Folate receptor, adult
  • Folbp1
  • FOLR
  • FOLR1
  • FR-alpha
  • KB cells FBP
  • MOv18
  • Ovarian tumor-associated antigen MOv18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
AF842
Species: Hu
Applications: WB
NBP2-43654
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06603
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-90367
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00002348-D01P
Species: Hu
Applications: WB, ICC/IF

Publications for FOLR1 Antibody (H00002348-D01P) (0)

There are no publications for FOLR1 Antibody (H00002348-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOLR1 Antibody (H00002348-D01P) (0)

There are no reviews for FOLR1 Antibody (H00002348-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FOLR1 Antibody (H00002348-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOLR1 Products

Bioinformatics Tool for FOLR1 Antibody (H00002348-D01P)

Discover related pathways, diseases and genes to FOLR1 Antibody (H00002348-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOLR1 Antibody (H00002348-D01P)

Discover more about diseases related to FOLR1 Antibody (H00002348-D01P).
 

Pathways for FOLR1 Antibody (H00002348-D01P)

View related products by pathway.

PTMs for FOLR1 Antibody (H00002348-D01P)

Learn more about PTMs related to FOLR1 Antibody (H00002348-D01P).
 

Research Areas for FOLR1 Antibody (H00002348-D01P)

Find related products by research area.

Blogs on FOLR1

There are no specific blogs for FOLR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOLR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOLR1
Entrez
Uniprot