FOLR1 Antibody

Western Blot: FOLR1 Antibody [H00002348-B01P] - Analysis of FOLR1 expression in transfected 293T cell line by FOLR1 polyclonal antibody. Lane 1: FOLR1 transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

FOLR1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: FOLR1 (AAH02947, 1 a.a. - 257 a.a.) full-length human protein. MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
• Specificity: FOLR1 - folate receptor 1 (adult),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: FOLR1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOLR1 Antibody

• Adult folate-binding protein
• FBP
• folate binding protein
• folate receptor 1 (adult)
• Folate receptor 1
• folate receptor alpha
• Folate receptor, adult
• Folbp1
• FOLR
• FOLR1
• FR-alpha
• KB cells FBP
• MOv18
• Ovarian tumor-associated antigen MOv18

Background

The protein encoded by this gene is a member of the folate receptor (FOLR) family. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This gene is composed of 7 exons; exons 1 through 4 encode the 5' UTR and exons 4 through 7 encode the open reading frame. Due to the presence of 2 promoters, multiple transcription start sites, and alternative splicing of exons, several transcript variants are derived from this gene. These variants differ in the lengths of 5' and 3' UTR, but they encode an identical amino acid sequence. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FOLR1 Antibody (H00002348-B01P)(2)

Publications using H00002348-B01P

• Emilia Moradi, Driton Vllasaliu, Martin Garnett et al. Ligand density and clustering effects on endocytosis of folate modified nanoparticles RSC Adv 2012-02-17 (ICC/IF, Human)
• Moradi E, Vllasaliu D, Garnett M et al. Ligand density and clustering effects on endocytosis of folate modified nanoparticles. RSC Adv. 2012-01-01

Bioinformatics

• Gene Symbol: FOLR1
• Entrez:
  • 2348(Human)
• Uniprot:
  • AAH02947.1(Human)