FMNL3 Antibody

Images

 
Western Blot: FMNL3 Antibody [NBP2-87451] - Host: Rabbit. Target Name: FMNL2. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FMNL3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FMNL3. Peptide sequence: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
FMNL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FMNL3 Antibody

  • formin-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP1-33431
Species: Hu
Applications: WB, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
NB600-231
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-47496
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023002-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP, PLA
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24615
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-80419
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-93579
Species: Hu
Applications: IHC, IHC-P
NBP1-84718
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P

Publications for FMNL3 Antibody (NBP2-87451) (0)

There are no publications for FMNL3 Antibody (NBP2-87451).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMNL3 Antibody (NBP2-87451) (0)

There are no reviews for FMNL3 Antibody (NBP2-87451). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FMNL3 Antibody (NBP2-87451) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FMNL3 Products

Bioinformatics Tool for FMNL3 Antibody (NBP2-87451)

Discover related pathways, diseases and genes to FMNL3 Antibody (NBP2-87451). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FMNL3 Antibody (NBP2-87451)

Discover more about diseases related to FMNL3 Antibody (NBP2-87451).
 

Pathways for FMNL3 Antibody (NBP2-87451)

View related products by pathway.

PTMs for FMNL3 Antibody (NBP2-87451)

Learn more about PTMs related to FMNL3 Antibody (NBP2-87451).

Blogs on FMNL3

There are no specific blogs for FMNL3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FMNL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FMNL3