![Western Blot: FMNL3 Antibody [NBP2-87451] - Host: Rabbit. Target Name: FMNL2. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/FMNL3 Antibody-Western Blot-NBP2-87451-img0001.jpg "Western Blot: FMNL3 Antibody [NBP2-87451] - Host: Rabbit. Target Name: FMNL2. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FMNL3. Peptide sequence: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FMNL3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for FMNL3 Antibody (NBP2-87451)Discover more about diseases related to FMNL3 Antibody (NBP2-87451).
| Pathways for FMNL3 Antibody (NBP2-87451)View related products by pathway.
|
PTMs for FMNL3 Antibody (NBP2-87451)Learn more about PTMs related to FMNL3 Antibody (NBP2-87451).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FMNL3 |
![Western Blot: FMNL2 Antibody [NBP2-24748] - Analysis of Formin-like protein 2 in whole mouse embryo body tissue lysate in the 1) absence and 2) presence of immunizing peptide using this antibody at 2 ug/ml.](http://images.novusbio.com/images2/FMNL2-Antibody-Western-Blot-NBP2-24748-img0009.jpg)
![Immunohistochemistry-Paraffin: FMNL2 Antibody [NBP2-24748] - Staining of normal human brain using this antibody (FMNL2, figure A and control rabbit Ig, figure B) at 6 ug/ml.](http://images.novusbio.com/images2/FMNL2-Antibody-Immunohistochemistry-Paraffin-NBP2-24748-img0008.jpg)
![Immunohistochemistry-Paraffin: FMNL2 Antibody [NBP2-24748] - Analysisof human brain, cortex using this antibody at 10 ug/ml.](http://images.novusbio.com/images2/FMNL2-Antibody-Immunohistochemistry-Paraffin-NBP2-24748-img0007.jpg)
![Western Blot: FMNL1 Antibody [NBP1-33431] - Sample (30 ug of whole cell lysate) A: Raji 5% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/images2/FMNL1 Antibody-Western Blot-NBP1-33431-img0003.jpg)
![Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-33431] - Paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/FMNL1 Antibody-Immunohistochemistry-Paraffin-NBP1-33431-img0002.jpg)
![Western Blot: FMNL1 Antibody [NBP1-33431] - H1299 lysates (Lane A) and Hela cells (Lane B) using NBP1-33431 at a dilution of 1:1000. 30ug whole cell lysate loaded on 7.5% SDS PAGE gel.](http://images.novusbio.com/images2/FMNL1 Antibody-Western Blot-NBP1-33431-img0001.jpg)
![ELISA: FMN1 Antibody [44110002]](http://images.novusbio.com/images/44110002-T01565A01.jpg)
![Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis using Anti-PRPF40A antibody NBP1-87933 (A) shows similar pattern to independent antibody NBP2-38400 (B).](http://images.novusbio.com/images2/FNBP3 Antibody-Western Blot-NBP1-87933-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: FNBP3 Antibody [NBP1-87933] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.](http://images.novusbio.com/images2/FNBP3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87933-img0009.jpg)
![Immunohistochemistry-Paraffin: FNBP3 Antibody [NBP1-87933] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/images2/FNBP3-Antibody-Immunohistochemistry-Paraffin-NBP1-87933-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: FHOD1 Antibody [NBP1-83900] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/FHOD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83900-img0004.jpg)
![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/images2/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0008.jpg)
![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human cerebellum shows no cytoplasmic positivity in Purkinje cells as expected.](http://images.novusbio.com/images2/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0005.jpg)
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining in human placenta and pancreas tissues using anti-DIAPH2 antibody. Corresponding DIAPH2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/DIAPH-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85217-img0015.jpg)
![Western Blot: DIAPH-2 Antibody [NBP1-85217] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/DIAPH-2-Antibody-Western-Blot-NBP1-85217-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: DIAPH-2 Antibody [NBP1-85217] - Staining of human cell line U-251 MG shows localization to nucleoli, endoplasmic reticulum and vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/DIAPH-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85217-img0016.jpg)
![Western Blot: GRID2IP Antibody [NBP1-94174] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG](http://images.novusbio.com/images2/GRID2IP Antibody-Western Blot-NBP1-94174-img0004.jpg)
![Immunohistochemistry-Paraffin: GRID2IP Antibody [NBP1-94174] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.](http://images.novusbio.com/images2/GRID2IP-Antibody-Immunohistochemistry-Paraffin-NBP1-94174-img0002.jpg)
![Western Blot: DIAPH1 Antibody [NB600-231] - Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Diaphanous 1 antibody used for WB at 0.66 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.](http://images.novusbio.com/images2/DIAPH1-Antibody-Western-Blot-NB600-231-img0009.jpg)
![Immunohistochemistry: DIAPH1 Antibody [NB600-231] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-Diaphanous used at a dilution of 1:1,000 ( 1ug/ml). Detection: DAB](http://images.novusbio.com/images2/DIAPH1-Antibody-Immunohistochemistry-NB600-231-img0010.jpg)
![Western Blot: DIAPH1 Antibody [NB600-231] - Whole cell lysate (50 ug/lane) from untreated or siRNA treated 293T cells. Antibody used at 0.1 ug/ml.](http://images.novusbio.com/images2/DIAPH1-Antibody-Western-Blot-NB600-231-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: DAAM2 Antibody [NBP2-47496] - ACM containing Wnt11-positive exosomes control CEP192, AURKB and PLK4 through DVL2. Model for DVL2 regulating recruitment of CEP192, AURKB and PLK4 to cell cortex in response to ACM stimulation. Image collected and cropped by CiteAb from the following publication (https://static-content.springer.com/esm/art%3A10.1038%2Fs41467-019-10241-w/MediaObjects/41467_2019_10241_MOESM1_ESM.pdf), licensed under a CC-BY licence.](http://images.novusbio.com/images2/DAAM2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47496-img0009.jpg)
![Immunohistochemistry-Paraffin: DAAM2 Antibody [NBP2-47496] - Staining of human placenta shows strong positivity in endothelial cells.](http://images.novusbio.com/images2/DAAM2-Antibody-Immunohistochemistry-Paraffin-NBP2-47496-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: DAAM2 Antibody [NBP2-47496] - Staining of human cell line HEK 293 shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/DAAM2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47496-img0004.jpg)
![Western Blot: DAAM1 Antibody (4H3) [H00023002-M03] - Analysis of DAAM1 expression in A-431 (Cat # L015V1).](http://images.novusbio.com/images2/DAAM1-Antibody-(4H3)-Western-Blot-H00023002-M03-img0006.jpg)
![Western Blot: DAAM1 Antibody (4H3) [H00023002-M03] - Analysis of DAAM1 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/images2/DAAM1-Antibody-(4H3)-Western-Blot-H00023002-M03-img0005.jpg)
![Western Blot: DAAM1 Antibody (4H3) [H00023002-M03] - Analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M03), clone 4H3. Lane 1: DAAM1 transfected lysatE (122.3 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/DAAM1 Antibody (4H3)-Western Blot-H00023002-M03-img0007.jpg)
![Immunohistochemistry-Paraffin: Filamin B Antibody [NBP1-90286] - Analysis in human prostate and skeletal muscle tissues using NBP1-90286 antibody. Corresponding Filamin B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Filamin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-90286-img0028.jpg)
![Immunohistochemistry-Paraffin: Filamin B Antibody [NBP1-90286] - Staining of human colon, placenta, prostate and skeletal muscle using Anti-Filamin B antibody NBP1-90286 (A) shows similar protein distribution across tissues to independent antibody NBP1-90285 (B).](http://images.novusbio.com/images2/Filamin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-90286-img0027.jpg)
![Western Blot: Filamin B Antibody [NBP1-90286] - Analysis in human cell lines A-549 and HEK293 using anti-FLNB antibody. Corresponding FLNB RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/images2/Filamin-B-Antibody-Western-Blot-NBP1-90286-img0017.jpg)
![Western Blot: FMN2 Antibody [NBP2-24615] - Analysis of FMN2 in human brain lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24615 at 0.25 ug/ml.](http://images.novusbio.com/images2/FMN2-Antibody-Western-Blot-NBP2-24615-img0001.jpg)
![Immunohistochemistry-Paraffin: FMN2 Antibody [NBP2-24615] - Tissue section of human brain using 1:300 dilution of FMN2 antibody. The signal was developed using HRP-labeled secondary and DAB reagent which followed counterstaining of nuclei with hematoxylin. This FMN2 antibody generated a nuclear and cytoplasmic staining primarily in the glial cells.](http://images.novusbio.com/images2/FMN2-Antibody-Immunohistochemistry-Paraffin-NBP2-24615-img0002.jpg)
![Western Blot: DIAPH3 Antibody [NBP2-80419] - Analysis of DIAPH3 on SiHa cell lysate using anti-DIAPH3 antibody at 1/500 dilution.](http://images.novusbio.com/images2/DIAPH3-Antibody-Western-Blot-NBP2-80419-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: DIAPH3 Antibody [NBP2-80419] - Staining DIAPH3 in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/DIAPH3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-80419-img0004.jpg)
![Immunohistochemistry-Paraffin: DIAPH3 Antibody [NBP2-80419] - Analysis in human kidney tissue using DIAPH3 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/DIAPH3-Antibody-Immunohistochemistry-Paraffin-NBP2-80419-img0006.jpg)
![Western Blot: FNBP1 Antibody [NBP2-24526] - analysis of FNBP1 in human liver lysate in the 1) absence and 2) presence of immunizing peptide using FNBP1 antibody at 0.1 ug/ml.](http://images.novusbio.com/images2/FNBP1 Antibody-Western Blot-NBP2-24526-img0001.jpg)
![Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-24526] - Formalin-fixed, paraffin-embedded human brain stained with FNBP1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.](http://images.novusbio.com/images2/FNBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-24526-img0002.jpg)
![Immunohistochemistry-Paraffin: FHDC1 Antibody [NBP1-93579] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/FHDC1-Antibody-Immunohistochemistry-Paraffin-NBP1-93579-img0001.jpg)
![Western Blot: WBP4 Antibody [NBP1-84718] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/WBP4-Antibody-Western-Blot-NBP1-84718-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: WBP4 Antibody [NBP1-84718] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/images2/WBP4 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84718-img0008.jpg)
![Immunohistochemistry-Paraffin: WBP4 Antibody [NBP1-84718] - Staining of human stomach shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/images2/WBP4-Antibody-Immunohistochemistry-Paraffin-NBP1-84718-img0006.jpg)
![Western Blot: Cortactin Antibody (SC61-08) [NBP2-67632] - Analysis of Cortactin on different lysates using anti-Cortactin antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: NIH/3T3 Lane 3: A431](http://images.novusbio.com/images2/Cortactin-Antibody-(SC61-08)-Western-Blot-NBP2-67632-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Cortactin-Antibody-(SC61-08)-Immunocytochemistry-Immunofluorescence-NBP2-67632-img0008.jpg)
![Immunohistochemistry-Paraffin: Cortactin Antibody (SC61-08) [NBP2-67632] - Analysis of paraffin-embedded mouse colon tissue using anti-Cortactin antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Cortactin-Antibody-(SC61-08)-Immunohistochemistry-Paraffin-NBP2-67632-img0006.jpg)
![Western Blot: FNBP4 Antibody [NBP2-14022] - Analysis in control (vector only transfected HEK293T lysate) and FNBP4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/FNBP4 Antibody-Western Blot-NBP2-14022-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: FNBP4 Antibody [NBP2-14022] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.](http://images.novusbio.com/images2/FNBP4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14022-img0003.jpg)
![Immunohistochemistry-Paraffin: FNBP4 Antibody [NBP2-14022] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.](http://images.novusbio.com/images2/FNBP4-Antibody-Immunohistochemistry-Paraffin-NBP2-14022-img0001.jpg)
![Western Blot: SRGAP2 Antibody [NBP1-88830] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30](http://images.novusbio.com/images2/SRGAP2-Antibody-Western-Blot-NBP1-88830-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: SRGAP2 Antibody [NBP1-88830] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/SRGAP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88830-img0006.jpg)
![Immunohistochemistry-Paraffin: SRGAP2 Antibody [NBP1-88830] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/images2/SRGAP2 Antibody-Immunohistochemistry-Paraffin-NBP1-88830-img0010.jpg)
![Immunohistochemistry-Paraffin: Gremlin 1 Antibody [NB100-56883] - Detection of Gremlin in human colon cancer tissue using antibody at 5 ug/ml.](http://images.novusbio.com/images2/Gremlin-1-Antibody-Immunohistochemistry-Paraffin-NB100-56883-img0002.jpg)
