FLRT1 Antibody (4E10)

Images

 
Sandwich ELISA: FLRT1 Antibody (4E10) [H00023769-M04] - Detection limit for recombinant GST tagged FLRT1 is 10 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FLRT1 Antibody (4E10) Summary

Immunogen
FLRT1 (AAH18370, 1 a.a. ~ 675 a.a) full length recombinant protein with GST tag.MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLI AFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDAT TLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLP RSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSI EEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRI STIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFS
Specificity
FLRT1 - fibronectin leucine rich transmembrane protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FLRT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FLRT1 Antibody (4E10)

  • fibronectin leucine rich transmembrane protein 1
  • Fibronectin-like domain-containing leucine-rich transmembrane protein 1
  • FLRT1
  • leucine-rich repeat transmembrane protein FLRT1
  • MGC21624

Background

This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. The family members may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular matrix. The encoded protein shares sequence similarity with two other family members, FLRT2 and FLRT3. This gene is expressed in kidney and brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2877
Species: Hu
Applications: WB
AF2795
Species: Hu
Applications: WB
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
AF1429
Species: Hu
Applications: WB
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF4990
Species: Hu, Mu
Applications: WB, IHC

Publications for FLRT1 Antibody (H00023769-M04) (0)

There are no publications for FLRT1 Antibody (H00023769-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLRT1 Antibody (H00023769-M04) (0)

There are no reviews for FLRT1 Antibody (H00023769-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FLRT1 Antibody (H00023769-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLRT1 Products

Bioinformatics Tool for FLRT1 Antibody (H00023769-M04)

Discover related pathways, diseases and genes to FLRT1 Antibody (H00023769-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLRT1 Antibody (H00023769-M04)

Discover more about diseases related to FLRT1 Antibody (H00023769-M04).
 

Pathways for FLRT1 Antibody (H00023769-M04)

View related products by pathway.

PTMs for FLRT1 Antibody (H00023769-M04)

Learn more about PTMs related to FLRT1 Antibody (H00023769-M04).
 

Research Areas for FLRT1 Antibody (H00023769-M04)

Find related products by research area.

Blogs on FLRT1

There are no specific blogs for FLRT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLRT1 Antibody (4E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol FLRT1
Entrez
OMIM
Uniprot