Flotillin 2 Antibody

Western Blot: Flotillin 2 Antibody [H00002319-B01P] - Analysis of FLOT2 expression in human liver.

Immunohistochemistry-Paraffin: Flotillin 2 Antibody [H00002319-B01P] - Analysis of purified antibody to FLOT2 on formalin-fixed paraffin-embedded human prostate. (antibody concentration 1.5 ug/ml)

Western Blot: Flotillin 2 Antibody [H00002319-B01P] - Analysis of FLOT2 expression in transfected 293T cell line by FLOT2 polyclonal antibody. Lane 1: FLOT2 transfected lysate(41.8 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Flotillin 2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: FLOT2 (AAH17292, 1 a.a. - 379 a.a.) full-length human protein. MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
• Specificity: FLOT2 - flotillin 2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: FLOT2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Flotillin 2 Antibody

• Epidermal surface antigen
• ESA1Membrane component chromosome 17 surface marker 1
• ESAchromosome 17, surface marker 1 (35kD protein identified bymonoclonal ECS-1)
• flotillin 2

Background

Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Flotillin 2 Antibody (H00002319-B01P)(1)

Publication using H00002319-B01P

• Chen TC, Lee SA, Hong TM et al. From midbody protein-protein interaction network construction to novel regulators in cytokinesis. J Proteome Res 2009-11-01 [PMID: 19799413]

Bioinformatics

• Gene Symbol: FLOT2
• Entrez:
  • 2319(Human)
• Uniprot:
  • AAH17292.2(Human)