Recombinant Human Flotillin-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Flotillin-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 126-225 of Human FLOT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDI

Protein/Peptide Type
Partial Recombinant Protein
Gene
FLOT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Flotillin-1 Protein

  • flotillin 1
  • flotillin-1
  • integral membrane component of caveolae

Background

Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00010211-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Flotillin-1 Partial Recombinant Protein (H00010211-Q01) (0)

There are no publications for Flotillin-1 Partial Recombinant Protein (H00010211-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flotillin-1 Partial Recombinant Protein (H00010211-Q01) (0)

There are no reviews for Flotillin-1 Partial Recombinant Protein (H00010211-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flotillin-1 Partial Recombinant Protein (H00010211-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Flotillin-1 Products

Bioinformatics Tool for Flotillin-1 Partial Recombinant Protein (H00010211-Q01)

Discover related pathways, diseases and genes to Flotillin-1 Partial Recombinant Protein (H00010211-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flotillin-1 Partial Recombinant Protein (H00010211-Q01)

Discover more about diseases related to Flotillin-1 Partial Recombinant Protein (H00010211-Q01).
 

Pathways for Flotillin-1 Partial Recombinant Protein (H00010211-Q01)

View related products by pathway.

PTMs for Flotillin-1 Partial Recombinant Protein (H00010211-Q01)

Learn more about PTMs related to Flotillin-1 Partial Recombinant Protein (H00010211-Q01).

Blogs on Flotillin-1

There are no specific blogs for Flotillin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Flotillin-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FLOT1