Recombinant Human FLJ10808 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FLJ10808 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-389 of Human FLJ10808 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
UBA6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FLJ10808 Protein

  • E1-L2
  • FLJ10808
  • FLJ23367
  • Monocyte protein 4
  • MOP4
  • MOP-4
  • UBA6, ubiquitin-activating enzyme E1
  • UBE1L2
  • Ubiquitin-activating enzyme 6
  • ubiquitin-activating enzyme E1-like 2
  • Ubiquitin-activating enzyme E1-like protein 2
  • ubiquitin-like modifier activating enzyme 6
  • ubiquitin-like modifier-activating enzyme 6

Background

Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8408
Species: Hu
Applications: WB
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-82785
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1137
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NB100-87021
Species: Hu
Applications: WB, IP, PLA
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-46270
Species: Hu
Applications: WB, IHC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-45243
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
H00055236-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FLJ10808 Recombinant Protein (H00055236-P01) (0)

There are no publications for FLJ10808 Recombinant Protein (H00055236-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ10808 Recombinant Protein (H00055236-P01) (0)

There are no reviews for FLJ10808 Recombinant Protein (H00055236-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FLJ10808 Recombinant Protein (H00055236-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FLJ10808 Products

Bioinformatics Tool for FLJ10808 Recombinant Protein (H00055236-P01)

Discover related pathways, diseases and genes to FLJ10808 Recombinant Protein (H00055236-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLJ10808 Recombinant Protein (H00055236-P01)

Discover more about diseases related to FLJ10808 Recombinant Protein (H00055236-P01).
 

Pathways for FLJ10808 Recombinant Protein (H00055236-P01)

View related products by pathway.

PTMs for FLJ10808 Recombinant Protein (H00055236-P01)

Learn more about PTMs related to FLJ10808 Recombinant Protein (H00055236-P01).

Blogs on FLJ10808

There are no specific blogs for FLJ10808, but you can read our latest blog posts.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FLJ10808 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UBA6