FKBP9 Antibody

Images

 
Western Blot: FKBP9 Antibody [NBP2-84936] - Host: Rabbit. Target Name: FKBP9. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKBP9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FKBP9. Peptide sequence: VASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (93%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (93%), Bovine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP9 Antibody

  • 63 kDa FK506-binding protein
  • DKFZp586B1723
  • FK506 binding protein 9, 63 kDa
  • FKBP60
  • FKBP63
  • FKBP-9
  • MGC126772,63 kDa FKBP
  • MGC138258
  • peptidyl-prolyl cis-trans isomerase FKBP9
  • PPIase
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30993
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-00253
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-30993
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB300-508
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP, ICC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP1-85364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009360-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-97946
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45861
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IF
NBP2-92773
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1397
Species: Hu, Mu, Bv, Ca, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-84936
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for FKBP9 Antibody (NBP2-84936) (0)

There are no publications for FKBP9 Antibody (NBP2-84936).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP9 Antibody (NBP2-84936) (0)

There are no reviews for FKBP9 Antibody (NBP2-84936). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP9 Antibody (NBP2-84936) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FKBP9 Products

Bioinformatics Tool for FKBP9 Antibody (NBP2-84936)

Discover related pathways, diseases and genes to FKBP9 Antibody (NBP2-84936). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP9 Antibody (NBP2-84936)

Discover more about diseases related to FKBP9 Antibody (NBP2-84936).

PTMs for FKBP9 Antibody (NBP2-84936)

Learn more about PTMs related to FKBP9 Antibody (NBP2-84936).

Blogs on FKBP9

There are no specific blogs for FKBP9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP9