FKBP15 Antibody

Images

 
Western Blot: FKBP15 Antibody [NBP1-82972] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-220
Immunohistochemistry-Paraffin: FKBP15 Antibody [NBP1-82972] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKBP15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FKBP15 Protein (NBP1-82972PEP)
Publications
Read Publications using NBP1-82972.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP15 Antibody

  • FK506 binding protein 15, 133kDa
  • FK506-binding protein 133kDa
  • FK506-binding protein 15
  • FKBP133
  • FKBP-133
  • FKBP-15,133 kDa FKBP
  • PPP1R76,133 kDa FK506-binding protein
  • regulatory subunit 76
  • WAFL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2307
Species: Hu
Applications: WB
NBP1-86859
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85288
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, SignalStim
NBP2-20471
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36754
Species: Hu
Applications: WB, IB, ICC/IF, IHC
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83887
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC

Publications for FKBP15 Antibody (NBP1-82972)(2)

Reviews for FKBP15 Antibody (NBP1-82972) (0)

There are no reviews for FKBP15 Antibody (NBP1-82972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP15 Antibody (NBP1-82972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP15 Products

Bioinformatics Tool for FKBP15 Antibody (NBP1-82972)

Discover related pathways, diseases and genes to FKBP15 Antibody (NBP1-82972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP15 Antibody (NBP1-82972)

Discover more about diseases related to FKBP15 Antibody (NBP1-82972).
 

Pathways for FKBP15 Antibody (NBP1-82972)

View related products by pathway.

Research Areas for FKBP15 Antibody (NBP1-82972)

Find related products by research area.

Blogs on FKBP15

There are no specific blogs for FKBP15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP15