Filaggrin family member 2 Antibody

Immunohistochemistry-Paraffin: Filaggrin family member 2 Antibody [NBP1-91901] - Staining of human skin shows keratinocyte positivity in epidermal cells.

• Reactivity: Hu
• Applications: IHC, IHC-P, PLA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Filaggrin family member 2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CGYSNSSGCGRPQNASSSCQSHRFGGQGNQFSYIQSGCQSGIKGGQGHGCVSGGQPSGCGQPESNPCSQSYSQRGYGARENGQPQNCGGQWRTGSSQSSCCG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FLG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Proximity Ligation Assay
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Proximity ligation assay reported in scientific literature (PMID: 29758285).
• Control Peptide:

  Filaggrin family member 2 Recombinant Protein Antigen (NBP1-91901PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Filaggrin family member 2 Antibody

• filaggrin family member 2
• filaggrin-2
• FLG-2

Background

FLG2, also known as Filaggrin-2, is a 248 kDa 2,391 amino acid protein, and is in the S100-fused protein family. This protein has also been shown to have interactions with AGO1, AMBRA1, ATG12, ATG13, and ATG4B. Disease research is currently being studied with relation to FDX1L and psoriasis, eczema herpeticumrenal, and cell carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Filaggrin family member 2 Antibody (NBP1-91901)(4)

Publications using NBP1-91901

• Kaymak T, Kaya B, Wuggenig P et al. IL-20 subfamily cytokines impair the oesophageal epithelial barrier by diminishing filaggrin in eosinophilic oesophagitis Gut 2022-05-25 [PMID: 35613844] (IHC-P, Mouse)
• Shih YH, Xu J, Kumar A, et al. Alterations of Immune and Keratinization Gene Expression in Papulopustular Rosacea by Whole Transcriptome Analysis J. Invest. Dermatol. 2019-11-06 [PMID: 31705873] (IHC, Human)
• Mohamad J, Sarig O, Godsel LM, et al. Filaggrin 2 Deficiency Results in Abnormal Cell-Cell Adhesion in the Cornified Cell Layers and Causes Peeling Skin Syndrome Type A. J Invest Dermatol. 2018-06-27 [PMID: 29758285] (PLA, Human)
• Molin S, Merl J, Dietrich KA et al. The hand eczema proteome: imbalance of epidermal barrier proteins. Br. J. Dermatol. 2014-09-21 [PMID: 25244099] (IHC-P, Human)
  
  Details:
  Filaggrin family member 2/Filaggrin2 or FLG2 antibody used for IHC on formalin-fixed paraffin-embedded skin biopsy samples from human chronic hand eczema (CHE) patients. Antibody used at 1:30 dilution and detected via LSAB method with DAKO REAL? Detection System, Alkaline Phosphatase/RED, Rabbit/Mouse (Figure 2).

Bioinformatics

• Gene Symbol: FLG2