Filaggrin family member 2 Antibody

Images

 
Immunohistochemistry-Paraffin: Filaggrin family member 2 Antibody [NBP1-91901] - Staining of human skin shows keratinocyte positivity in epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Filaggrin family member 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CGYSNSSGCGRPQNASSSCQSHRFGGQGNQFSYIQSGCQSGIKGGQGHGCVSGGQPSGCGQPESNPCSQSYSQRGYGARENGQPQNCGGQWRTGSSQSSCCG
Specificity
Specificity of human Filaggrin family member 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Proximity Ligation Assay
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Proximity ligation assay reported in scientific literature (PMID: 29758285).
Control Peptide
Filaggrin family member 2 Recombinant Protein Antigen (NBP1-91901PEP)
Publications
Read Publications using
NBP1-91901 in the following applications:

  • IHC
    1 publication
  • 1 publication
  • PLA
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Filaggrin family member 2 Antibody

  • filaggrin family member 2
  • filaggrin-2
  • FLG-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87528
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5725
Species: Hu
Applications: WB, IHC
NBP1-86950
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-86134
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF944
Species: Hu
Applications: WB, IHC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-44643
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready
NB120-3588
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP2-34062
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41187
Species: Hu
Applications: WB, ELISA, IF
NB100-65599
Species: Hu, Ma, Md
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP

Publications for Filaggrin family member 2 Antibody (NBP1-91901)(3)

Reviews for Filaggrin family member 2 Antibody (NBP1-91901) (0)

There are no reviews for Filaggrin family member 2 Antibody (NBP1-91901). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Filaggrin family member 2 Antibody (NBP1-91901) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Filaggrin family member 2 Products

Bioinformatics Tool for Filaggrin family member 2 Antibody (NBP1-91901)

Discover related pathways, diseases and genes to Filaggrin family member 2 Antibody (NBP1-91901). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Filaggrin family member 2 Antibody (NBP1-91901)

Discover more about diseases related to Filaggrin family member 2 Antibody (NBP1-91901).
 

Pathways for Filaggrin family member 2 Antibody (NBP1-91901)

View related products by pathway.

PTMs for Filaggrin family member 2 Antibody (NBP1-91901)

Learn more about PTMs related to Filaggrin family member 2 Antibody (NBP1-91901).

Blogs on Filaggrin family member 2

There are no specific blogs for Filaggrin family member 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Filaggrin family member 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLG2