Fibrinopeptide B Antibody [DyLight 650]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

Fibrinopeptide B Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 111-222 of human Fibrinopeptide B (NP_005132.2).
  
  Sequence:
  QLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Fibrinopeptide B Antibody [DyLight 650]

• Beta-Fibrinogen
• FGB Peptide
• FIBB
• Fibrinogen beta chain
• Fibrinogen Type II
• fibrinogen, B beta polypeptide
• Fibrinopeptide B
• FPB
• MGC104327
• MGC120405

Background

The protein encoded by the Fibrinopeptide B gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of threepairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrinwhich is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrinregulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for severalcell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia,hypodysfibrinogenemia and thrombotic tendency. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGB