Fibrillin 2 Antibody (1C2)

Images

 
Sandwich ELISA: Fibrillin 2 Antibody (1C2) [H00002201-M01] - Detection limit for recombinant GST tagged FBN2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fibrillin 2 Antibody (1C2) Summary

Immunogen
FBN2 (NP_001990.2 2776 a.a. - 2876 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSKEHILELRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSYLHTAKKKLMPGTYTLEITSIP
Specificity
The protein encoded by this gene is a component of connective tissue microfibrils and may be involved in elastic fiber assembly. Mutations in this gene cause congenital contractural arachnodactyly. [provided by RefSeq
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FBN2
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fibrillin 2 Antibody (1C2)

  • CCA
  • congenital contractural arachnodactyly
  • DA9
  • fibrillin 2
  • fibrillin 5
  • fibrillin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF2009
Species: Hu
Applications: WB, IHC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00002201-M01
Species: Hu
Applications: WB, ELISA

Publications for Fibrillin 2 Antibody (H00002201-M01) (0)

There are no publications for Fibrillin 2 Antibody (H00002201-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibrillin 2 Antibody (H00002201-M01) (0)

There are no reviews for Fibrillin 2 Antibody (H00002201-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibrillin 2 Antibody (H00002201-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibrillin 2 Products

Bioinformatics Tool for Fibrillin 2 Antibody (H00002201-M01)

Discover related pathways, diseases and genes to Fibrillin 2 Antibody (H00002201-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibrillin 2 Antibody (H00002201-M01)

Discover more about diseases related to Fibrillin 2 Antibody (H00002201-M01).
 

Pathways for Fibrillin 2 Antibody (H00002201-M01)

View related products by pathway.

PTMs for Fibrillin 2 Antibody (H00002201-M01)

Learn more about PTMs related to Fibrillin 2 Antibody (H00002201-M01).
 

Research Areas for Fibrillin 2 Antibody (H00002201-M01)

Find related products by research area.

Blogs on Fibrillin 2

There are no specific blogs for Fibrillin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibrillin 2 Antibody (1C2) and receive a gift card or discount.

Bioinformatics

Gene Symbol FBN2