FGF-16 Antibody - BSA Free

Western Blot: FGF-16 Antibody [NBP3-09433] - Western blot analysis of FGF-16 in MCF7 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FGF-16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FGF-16 Antibody - BSA Free (NBP3-09433) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGF-16 (NP_003859). Peptide sequence REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGF16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FGF-16 Antibody - BSA Free

• FGF16
• FGF-16
• fibroblast growth factor 16

Background

The protein encoded by the FGF16 gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The rat homolog is predominantly expressed in embryonic brown adipose tissue and has significant mitogenic activity, which suggests a role in proliferation of embryonic brown adipose tissue. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGF16