FEZ1 Antibody

Images

 
Western Blot: FEZ1 Antibody [H00009638-B02P] - Analysis of FEZ1 expression in transfected 293T cell line by FEZ1 polyclonal antibody. Lane 1: FEZ1 transfected lysate(43.12 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FEZ1 Antibody Summary

Immunogen
FEZ1 (NP_005094.1, 1 a.a. - 392 a.a.) full-length human protein. MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEKKASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT
Specificity
FEZ1 - fasciculation and elongation protein zeta 1 (zygin I),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FEZ1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate for western blot. It has also been used for ELISA.
Publications
Read Publication using
H00009638-B02P in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FEZ1 Antibody

  • fasciculation and elongation protein zeta 1 (zygin I)
  • fasciculation and elongation protein zeta-1
  • Zygin I
  • zygin-1

Background

This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fasciculation, suggesting that it also functions in axonal outgrowth. The N-terminal half of the gene product is highly acidic. Alternatively spliced transcript variants encoding different isoforms of this protein have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83907
Species: Hu
Applications: IHC, IHC-P
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01086
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01171
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, S-ELISA
NBP1-72058
Species: Hu
Applications: WB, PEP-ELISA
NBP2-41152
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for FEZ1 Antibody (H00009638-B02P)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FEZ1 Antibody (H00009638-B02P) (0)

There are no reviews for FEZ1 Antibody (H00009638-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FEZ1 Antibody (H00009638-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FEZ1 Products

Bioinformatics Tool for FEZ1 Antibody (H00009638-B02P)

Discover related pathways, diseases and genes to FEZ1 Antibody (H00009638-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FEZ1 Antibody (H00009638-B02P)

Discover more about diseases related to FEZ1 Antibody (H00009638-B02P).
 

Pathways for FEZ1 Antibody (H00009638-B02P)

View related products by pathway.

PTMs for FEZ1 Antibody (H00009638-B02P)

Learn more about PTMs related to FEZ1 Antibody (H00009638-B02P).
 

Research Areas for FEZ1 Antibody (H00009638-B02P)

Find related products by research area.

Blogs on FEZ1

There are no specific blogs for FEZ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FEZ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FEZ1
Entrez
Uniprot