FEZ1 Antibody - Azide and BSA Free

Western Blot: FEZ1 Antibody [H00009638-B02P] - Analysis of FEZ1 expression in transfected 293T cell line by FEZ1 polyclonal antibody. Lane 1: FEZ1 transfected lysate(43.12 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FEZ1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse FEZ1 Antibody - Azide and BSA Free (H00009638-B02P) is a polyclonal antibody validated for use in WB. Anti-FEZ1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FEZ1 (NP_005094.1, 1 a.a. - 392 a.a.) full-length human protein. MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEKKASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT
• Specificity: FEZ1 - fasciculation and elongation protein zeta 1 (zygin I),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: FEZ1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FEZ1 Antibody - Azide and BSA Free

• fasciculation and elongation protein zeta 1 (zygin I)
• fasciculation and elongation protein zeta-1
• Zygin I
• zygin-1

Background

This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fasciculation, suggesting that it also functions in axonal outgrowth. The N-terminal half of the gene product is highly acidic. Alternatively spliced transcript variants encoding different isoforms of this protein have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FEZ1 Antibody (H00009638-B02P)(2)

Publications using H00009638-B02P

• Viacheslav M, Nathan M, Lacy S et al. FEZ1 phosphorylation regulates HSPA8 localization and interferon-stimulated gene expression. Cell Rep. 2022-02-15 [PMID: 35172151]
• McKnight NC, Jefferies HB, Alemu EA et al. Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC. EMBO J. 2012-04-18 [PMID: 22354037] (WB, Human)

Bioinformatics

• Gene Symbol: FEZ1
• Entrez:
  • 9638(Human)
• Uniprot:
  • NP_005094.1(Human)