FENS1 Antibody

Images

 
Immunohistochemistry-Paraffin: FENS1 Antibody [NBP2-13521] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FENS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYP AHQNRVSAIIFSLATEWVISTGH
Marker
Early Endosome Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDFY1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FENS1 Protein (NBP2-13521PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FENS1 Antibody

  • FENS-1Zinc finger FYVE domain-containing protein 17
  • KIAA1435
  • Phosphoinositide-binding protein 1
  • WD repeat and FYVE domain containing 1
  • WD repeat and FYVE domain-containing protein 1
  • WD40 and FYVE domain containing 1
  • WDF1WD40- and FYVE domain-containing protein 1
  • ZFYVE17phosphoinositide-binding protein SR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20950
Species: Hu
Applications: WB, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
MAB5248
Species: Hu
Applications: IHC
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1030
Species: Hu
Applications: WB, ChIP, PEP-ELISA
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NBP2-00576
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-32664
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98414
Species: Hu, Mu
Applications: WB
NBP1-83606
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13521
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for FENS1 Antibody (NBP2-13521) (0)

There are no publications for FENS1 Antibody (NBP2-13521).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FENS1 Antibody (NBP2-13521) (0)

There are no reviews for FENS1 Antibody (NBP2-13521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FENS1 Antibody (NBP2-13521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FENS1 Products

Bioinformatics Tool for FENS1 Antibody (NBP2-13521)

Discover related pathways, diseases and genes to FENS1 Antibody (NBP2-13521). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FENS1 Antibody (NBP2-13521)

Discover more about diseases related to FENS1 Antibody (NBP2-13521).
 

Pathways for FENS1 Antibody (NBP2-13521)

View related products by pathway.

Blogs on FENS1

There are no specific blogs for FENS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FENS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDFY1