
Western Blot: FCRLM1 Antibody [NBP1-69351] - This Anti-FCRLA antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FCRLA/FCRLM1 Antibody Summary

Synthetic peptides corresponding to FCRLA(Fc receptor-like A) The peptide sequence was selected from the C terminal of FCRLA. Peptide sequence MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FCRLA and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FCRLA/FCRLM1 Antibody

  • Fc receptor homolog expressed in B cells (FREB)
  • Fc receptor homolog expressed in B-cells
  • Fc receptor related protein X
  • Fc receptor-like A
  • Fc receptor-like and mucin-like 1
  • Fc receptor-related protein X
  • FCRL1
  • FCRLb
  • FCRLc1
  • FCRLc2
  • FCRLd
  • FCRLe
  • FCRLFc receptor-like protein
  • FCRLM1
  • FcRX
  • FREB
  • FREBFc receptor-like and mucin-like protein 1
  • MGC4595


Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.Receptors for the Fc fragment of IgG, or FCGRs (see MIM 146790), are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. All FCGR genes map to human chromosome 1. Additional genes in this region, including FREB, encode FCGR homologs that are selectively expressed in B cells and may be implicated in B-cell development and lymphomagenesis.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-742 BM471887.1 3-744 743-1338 BC006521.2 558-1153 1339-1684 BX112608.1 318-663 1685-2357 BX649184.1 2243-2915


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB

Publications for FCRLA/FCRLM1 Antibody (NBP1-69351) (0)

There are no publications for FCRLA/FCRLM1 Antibody (NBP1-69351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCRLA/FCRLM1 Antibody (NBP1-69351) (0)

There are no reviews for FCRLA/FCRLM1 Antibody (NBP1-69351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCRLA/FCRLM1 Antibody (NBP1-69351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FCRLA/FCRLM1 Products

Bioinformatics Tool for FCRLA/FCRLM1 Antibody (NBP1-69351)

Discover related pathways, diseases and genes to FCRLA/FCRLM1 Antibody (NBP1-69351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCRLA/FCRLM1 Antibody (NBP1-69351)

Discover more about diseases related to FCRLA/FCRLM1 Antibody (NBP1-69351).

Pathways for FCRLA/FCRLM1 Antibody (NBP1-69351)

View related products by pathway.

PTMs for FCRLA/FCRLM1 Antibody (NBP1-69351)

Learn more about PTMs related to FCRLA/FCRLM1 Antibody (NBP1-69351).


There are no specific blogs for FCRLA/FCRLM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FCRLA/FCRLM1 Antibody and receive a gift card or discount.


Gene Symbol FCRLA