FCP1 Recombinant Protein Antigen

Images

 
There are currently no images for FCP1 Recombinant Protein Antigen (NBP2-68899PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FCP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FCP1.

Source: E.coli

Amino Acid Sequence: IFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDKVEEQLFPLRDDHTK

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CTDP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68899. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FCP1 Recombinant Protein Antigen

  • CCFDN
  • CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase
  • CTD of POLR2A, phosphatase of, subunit 1
  • EC 3.1.3.16
  • FCP1TFIIF-associating CTD phosphatase 1
  • RNA polymerase II subunit A C-terminal domain phosphatase
  • serine phosphatase FCP1a
  • subunit 1
  • TFIIF-associating CTD phosphatase
  • transcription factor IIF-associating CTD phosphatase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBL1-11392
Species: Hu
NB100-61060
Species: Hu, Mu
Applications: WB, ChIP, IP
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65250
Species: Hu
NBP1-02161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71822
Species: Hu
Applications: WB, IP
NBP2-68899PEP
Species: Hu
Applications: AC

Publications for FCP1 Recombinant Protein Antigen (NBP2-68899PEP) (0)

There are no publications for FCP1 Recombinant Protein Antigen (NBP2-68899PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCP1 Recombinant Protein Antigen (NBP2-68899PEP) (0)

There are no reviews for FCP1 Recombinant Protein Antigen (NBP2-68899PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FCP1 Recombinant Protein Antigen (NBP2-68899PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FCP1 Recombinant Protein Antigen (NBP2-68899PEP)

Discover related pathways, diseases and genes to FCP1 Recombinant Protein Antigen (NBP2-68899PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCP1 Recombinant Protein Antigen (NBP2-68899PEP)

Discover more about diseases related to FCP1 Recombinant Protein Antigen (NBP2-68899PEP).
 

Pathways for FCP1 Recombinant Protein Antigen (NBP2-68899PEP)

View related products by pathway.

PTMs for FCP1 Recombinant Protein Antigen (NBP2-68899PEP)

Learn more about PTMs related to FCP1 Recombinant Protein Antigen (NBP2-68899PEP).
 

Research Areas for FCP1 Recombinant Protein Antigen (NBP2-68899PEP)

Find related products by research area.

Blogs on FCP1

There are no specific blogs for FCP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SCP1 Antibody
NB300-229
FCP1 Antibody (3G4)
H00009150-M04

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FCP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CTDP1