FCHO2 Antibody

Images

 
Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCHO2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KGTGKERPGLIEFEECDTASAVEGIKPRKRKTFALPGIIKKEKDAESVECPDADSLNIPDVDEEGYSI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCHO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FCHO2 Protein (NBP1-90904PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FCHO2 Antibody

  • FCH domain only 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16458
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-76845
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8064
Species: Hu
Applications: WB, IHC, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for FCHO2 Antibody (NBP1-90904) (0)

There are no publications for FCHO2 Antibody (NBP1-90904).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCHO2 Antibody (NBP1-90904) (0)

There are no reviews for FCHO2 Antibody (NBP1-90904). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FCHO2 Antibody (NBP1-90904) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCHO2 Products

FCHO2 NBP1-90904

Bioinformatics Tool for FCHO2 Antibody (NBP1-90904)

Discover related pathways, diseases and genes to FCHO2 Antibody (NBP1-90904). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCHO2 Antibody (NBP1-90904)

Discover more about diseases related to FCHO2 Antibody (NBP1-90904).
 

Pathways for FCHO2 Antibody (NBP1-90904)

View related products by pathway.

Blogs on FCHO2

There are no specific blogs for FCHO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FCHO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCHO2