FCHO2 Antibody - BSA Free

Staining of human endometrium, kidney, placenta and skeletal muscle using NBP1-90904 (A) shows similar protein distribution across tissues to independent antibody NBP2-32694 (B).

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human endometrium, kidney, placenta and skeletal muscle HPA037686 (A) shows similar protein distribution across tissues to independent antibody HPA037685 (B).

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FCHO2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGTGKERPGLIEFEECDTASAVEGIKPRKRKTFALPGIIKKEKDAESVECPDADSLNIPDVDEEGYSI
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCHO2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FCHO2 Recombinant Protein Antigen (NBP1-90904PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FCHO2 Antibody - BSA Free

• FCH domain only 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FCHO2