FCHO2 Antibody - BSA Free

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904] - Staining of human testis.

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904] - Staining of human placenta.

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904] - Staining of human colon.

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904] - Staining of human lymph node.

Staining of human endometrium, kidney, placenta and skeletal muscle using NBP1-90904 (A) shows similar protein distribution across tissues to independent antibody NBP2-32694 (B).

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FCHO2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FCHO2 Antibody - BSA Free (NBP1-90904) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGTGKERPGLIEFEECDTASAVEGIKPRKRKTFALPGIIKKEKDAESVECPDADSLNIPDVDEEGYSI
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCHO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FCHO2 Protein (NBP1-90904PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FCHO2 Antibody - BSA Free

• FCH domain only 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FCHO2