Fc epsilon RI beta/MS4A2 Antibody (3B1) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
MS4A2 (NP_000130, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE |
| Specificity |
MS4A2 (3B1) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MS4A2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Fc epsilon RI beta/MS4A2 Antibody (3B1) - Azide and BSA Free
Background
The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for Fc epsilon RI beta/MS4A2 Antibody (H00002206-M02) (0)
There are no publications for Fc epsilon RI beta/MS4A2 Antibody (H00002206-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Fc epsilon RI beta/MS4A2 Antibody (H00002206-M02) (0)
There are no reviews for Fc epsilon RI beta/MS4A2 Antibody (H00002206-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Fc epsilon RI beta/MS4A2 Antibody (H00002206-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Fc epsilon RI beta/MS4A2 Products
Research Areas for Fc epsilon RI beta/MS4A2 Antibody (H00002206-M02)
Find related products by research area.
|
Blogs on Fc epsilon RI beta/MS4A2