Recombinant Human FBXW7/Cdc4 Protein

Images

 
Recombinant Human FBXW7/Cdc4 Protein [H00055294-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FBXW7/Cdc4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 599-707 of Human FBXW7/Cdc4

Source: Wheat Germ

Amino Acid Sequence: ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK) with GST-Tag at N-Terminal.

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXW7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXW7/Cdc4 Protein

  • AGO
  • AGOFBXO30
  • Archipelago Homolog
  • archipelago, Drosophila, homolog of
  • Cdc4
  • CDC4FLJ16457
  • F-box and WD repeat domain containing 7
  • F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila)
  • F-box and WD-40 domain-containing protein 7
  • F-box protein FBW7
  • F-box protein FBX30
  • F-box protein SEL-10
  • F-box/WD repeat-containing protein 7
  • FBW6
  • Fbw7
  • FBW7hCdc4
  • FBX30
  • FBX30FLJ11071
  • FBXO30
  • FBXW6
  • FBXW7
  • hAgo
  • homolog of C elegans sel-10
  • SCF(Fbw7)
  • SEL10
  • SEL-10DKFZp686F23254
  • SEL10FBW6

Background

FBXW7 - F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56198
Species: Hu, Dr
Applications: EM, PEP-ELISA
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00055294-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01) (0)

There are no publications for FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01) (0)

There are no reviews for FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXW7/Cdc4 Products

Bioinformatics Tool for FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01)

Discover related pathways, diseases and genes to FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01)

Discover more about diseases related to FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01).
 

Pathways for FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01)

View related products by pathway.

PTMs for FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01)

Learn more about PTMs related to FBXW7/Cdc4 Partial Recombinant Protein (H00055294-Q01).

Blogs on FBXW7/Cdc4

There are no specific blogs for FBXW7/Cdc4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXW7/Cdc4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW7
Entrez