FBXW5 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FBXW5 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXW5.
  
  

  Source: E. coli

  Amino Acid Sequence: PDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FBXW5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91892.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FBXW5 Recombinant Protein Antigen

• DKFZp434B205
• F-box and WD repeat domain containing 5
• F-box and WD-40 domain protein 5
• F-box and WD-40 domain-containing protein 5
• F-box/WD repeat-containing protein 5
• Fbw5
• MGC20962
• RP11-229P13.10
• WD repeat-containing F-box protein FBW5

Background

The FBXW5 gene encodes a F-box/WD repeat-containing protein 5 that exists in two isoforms. Isoform 1 is 556 amino acids long, at nearly 64 kDA while isoform 2 is 377 amino acids long at 42 kDA. This protein encoded by this gene functions in substrate recognition of SCF as well as DCX E3 ubiquitin-protein ligase complexes. It may also work as a negative regulator of MAP3K7/TAK1 signaling in the interleukin-1B signaling pathway. FBXW5 participates in protein chaperonin-mediated protein folding and metabolism as well as the association of TriC/CCT with target proteins during biosynthesis. It is known to interact with genes CUL1, MDFI, SKP1, KRTAP4-12, and UBE2R2. FBXW5 is associated with tuberous sclerosis as well as hepatitis b.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FBXW5