FBXW2 Antibody

Images

 
Western Blot: FBXW2 Antibody [NBP1-55043] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate FBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat
Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: FBXW2 Antibody [NBP1-55043] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXW2 Antibody Summary

Immunogen
Synthetic peptides corresponding to FBXW2(F-box and WD repeat domain containing 2) The peptide sequence was selected from the middle region of FBXW2. Peptide sequence SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXW2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FBXW2 and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FBXW2 Antibody

  • F-box and WD repeat domain containing 2
  • F-box and WD-40 domain protein 2
  • F-box and WD-40 domain-containing protein 2
  • F-box/WD repeat-containing protein 2
  • FBW2Fwd2
  • FWD2
  • Md6
  • MGC117371
  • Protein MD6

Background

F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-40 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. FBXW2 is the second identified member of the F-box family and contains multiple WD-40 repeats.F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-40 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. This gene encodes the second identified member of the F-box gene family and contains multiple WD-40 repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

255-SC/CF
Species: Hu
Applications: BA
H00008521-M05
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP3-16092
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-20380
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-61712
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-52158
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84850
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00026224-M03
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-59631
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84721
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-98880
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for FBXW2 Antibody (NBP1-55043) (0)

There are no publications for FBXW2 Antibody (NBP1-55043).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW2 Antibody (NBP1-55043) (0)

There are no reviews for FBXW2 Antibody (NBP1-55043). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXW2 Antibody (NBP1-55043) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXW2 Products

Bioinformatics Tool for FBXW2 Antibody (NBP1-55043)

Discover related pathways, diseases and genes to FBXW2 Antibody (NBP1-55043). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXW2 Antibody (NBP1-55043)

Discover more about diseases related to FBXW2 Antibody (NBP1-55043).
 

Pathways for FBXW2 Antibody (NBP1-55043)

View related products by pathway.

PTMs for FBXW2 Antibody (NBP1-55043)

Learn more about PTMs related to FBXW2 Antibody (NBP1-55043).

Blogs on FBXW2

There are no specific blogs for FBXW2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXW2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW2
Uniprot