FBXO31 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FBXO31 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXO31.
  
  

  Source: E. coli

  Amino Acid Sequence: HVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FBXO31
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83916.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

  For further blocking peptide related information and a protocol, click here.

• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FBXO31 Recombinant Protein Antigen

• DKFZp434B027
• F-box only protein 31
• F-box protein 31
• FBX14DKFZp434J1815
• Fbx31
• FBXO14FLJ22477
• MGC15419
• MGC9527
• pp2386
• putative breast cancer tumor-suppressor
• SCF ubiquitin ligase specificity factor

Background

Belonging to the FBXO31 family, F-box only protein 31 (FBXO31) is a component of the SCF (SKP1-cullin-F-box) ubiquitin ligase complex and is involved in cyclin binding. At the protein level, FBXO31 plays a central role in G1 arrest following DNA damage. More specifically, these F-box proteins interact with SKP1 and recognize phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, thus resulting in G1 arrest. Diseases associated with FBXO31 include breast cancer, mast cell neoplasm, esophagitis and carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXO31