FBXO2 Antibody (1G4)

Images

 
Western Blot: FBXO2 Antibody (1G4) [H00026232-M01] - Analysis of FBXO2 expression in transfected 293T cell line by FBXO2 monoclonal antibody (M01), clone 1G4.Lane 1: FBXO2 transfected lysate(33.3 KDa).Lane 2: ...read more
Sandwich ELISA: FBXO2 Antibody (1G4) [H00026232-M01] - Detection limit for recombinant GST tagged FBXO2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FBXO2 Antibody (1G4) Summary

Immunogen
FBXO2 (AAH25233, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Specificity
FBXO2 - F-box protein 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FBXO2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactive against recombinant protein on ELISA. It has also been used for Western Blot.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXO2 Antibody (1G4)

  • FBG1
  • F-box gene 1
  • F-box only protein 2
  • F-box protein 2
  • Fbs1
  • FBX2Fbg1
  • NFB42
  • OCP1
  • organ of Corti protein 1

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is highly similar to the rat NFB42 (neural F Box 42 kDa) protein which is enriched in the nervous system and may play a role in maintaining neurons in a postmitotic state.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

255-SC/CF
Species: Hu
Applications: BA
NBP2-20380
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-15332
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-87122
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00009978-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-466
Species: Hu, Mu, Rt
Applications: WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
538-MG
Species: Rt
Applications: BA
NBP1-86665
Species: Hu
Applications: IHC, IHC-P, WB
AF1440
Species: Mu
Applications: WB

Publications for FBXO2 Antibody (H00026232-M01) (0)

There are no publications for FBXO2 Antibody (H00026232-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO2 Antibody (H00026232-M01) (0)

There are no reviews for FBXO2 Antibody (H00026232-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXO2 Antibody (H00026232-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXO2 Products

Bioinformatics Tool for FBXO2 Antibody (H00026232-M01)

Discover related pathways, diseases and genes to FBXO2 Antibody (H00026232-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO2 Antibody (H00026232-M01)

Discover more about diseases related to FBXO2 Antibody (H00026232-M01).
 

Pathways for FBXO2 Antibody (H00026232-M01)

View related products by pathway.

PTMs for FBXO2 Antibody (H00026232-M01)

Learn more about PTMs related to FBXO2 Antibody (H00026232-M01).
 

Research Areas for FBXO2 Antibody (H00026232-M01)

Find related products by research area.

Blogs on FBXO2

There are no specific blogs for FBXO2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO2 Antibody (1G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO2
Entrez
OMIM
Uniprot