Recombinant Human FBXL5 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FBXL5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 584-691 of Human FBXL5

Source: Wheat Germ

Amino Acid Sequence: LIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXL5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXL5 Protein

  • FBL5FBL4F-box protein FBL5
  • F-box and leucine-rich repeat protein 5p45SKP2-like protein
  • F-box protein FBL4/FBL5
  • FLR1F-box/LRR-repeat protein 5

Background

FBXL5 - F-box and leucine-rich repeat protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1798
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59337
Species: Hu
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF5708
Species: Hu
Applications: WB, ICC
NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-82598
Species: Hu
Applications: WB, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-57758
Species: Hu
Applications: ICC/IF

Publications for FBXL5 Partial Recombinant Protein (H00026234-Q01) (0)

There are no publications for FBXL5 Partial Recombinant Protein (H00026234-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL5 Partial Recombinant Protein (H00026234-Q01) (0)

There are no reviews for FBXL5 Partial Recombinant Protein (H00026234-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL5 Partial Recombinant Protein (H00026234-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXL5 Products

Bioinformatics Tool for FBXL5 Partial Recombinant Protein (H00026234-Q01)

Discover related pathways, diseases and genes to FBXL5 Partial Recombinant Protein (H00026234-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL5 Partial Recombinant Protein (H00026234-Q01)

Discover more about diseases related to FBXL5 Partial Recombinant Protein (H00026234-Q01).
 

Pathways for FBXL5 Partial Recombinant Protein (H00026234-Q01)

View related products by pathway.

PTMs for FBXL5 Partial Recombinant Protein (H00026234-Q01)

Learn more about PTMs related to FBXL5 Partial Recombinant Protein (H00026234-Q01).

Blogs on FBXL5

There are no specific blogs for FBXL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

YAP1 Antibody
NB110-58358
FBXL5 Antibody
NBP1-54918

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXL5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL5