We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Fatty acid desaturase 2 Recombinant Protein Antigen

Images

 
There are currently no images for Fatty acid desaturase 2 Protein (NBP1-84311PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Fatty acid desaturase 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FADS2.

Source: E. coli

Amino Acid Sequence: GKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FADS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84311.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fatty acid desaturase 2 Recombinant Protein Antigen

  • D6D
  • D6DLLCDL2
  • Delta(6) desaturase
  • Delta(6) fatty acid desaturase
  • Delta-6 desaturase
  • delta-6 fatty acid desaturase
  • delta-6-desaturase
  • DES6
  • EC 1.14.19
  • EC 1.14.19.-
  • EC 1.14.19.3
  • FADS2
  • FADSD6
  • Fatty acid desaturase 2
  • linoleoyl-CoA desaturase (delta-6-desaturase)-like 2
  • SLL0262
  • TU13

Background

The protein encoded by the Fatty acid desaturase 2 gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-22409
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
AF7550
Species: Hu
Applications: IP, KO, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NBP3-46533
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-95204
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-47863
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-82180
Species: Hu
Applications: ELISA
NB100-2564
Species: Hu
Applications: WB
NBP2-59478
Species: Hu
Applications: ELISA, ICC/IF, WB
DTM100
Species: Hu
Applications: ELISA
NBP1-91877
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-47877
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-33500
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-04888
Species: Hu, Rt
Applications: WB
NBP3-47382
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-38958
Species: Hu
Applications: IHC,  IHC-P
NBP2-46376
Species: Hu
Applications: IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB

Publications for Fatty acid desaturase 2 Protein (NBP1-84311PEP) (0)

There are no publications for Fatty acid desaturase 2 Protein (NBP1-84311PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fatty acid desaturase 2 Protein (NBP1-84311PEP) (0)

There are no reviews for Fatty acid desaturase 2 Protein (NBP1-84311PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fatty acid desaturase 2 Protein (NBP1-84311PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fatty acid desaturase 2 Products

Research Areas for Fatty acid desaturase 2 Protein (NBP1-84311PEP)

Find related products by research area.

Blogs on Fatty acid desaturase 2

There are no specific blogs for Fatty acid desaturase 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fatty acid desaturase 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FADS2