We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Fast skeletal myosin light chain 2 Recombinant Protein Antigen

Images

 
There are currently no images for Fast skeletal myosin light chain 2 Recombinant Protein Antigen (NBP2-62625PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Fast skeletal myosin light chain 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYLPF.

Source: E. coli

Amino Acid Sequence: KGTIKKKFLEELLTTQCDRFSQEEIKNMWAAF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYL11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62625.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fast skeletal myosin light chain 2 Recombinant Protein Antigen

  • DKFZp779C0757
  • Fast skeletal myosin light chain 2
  • HUMMLC2B
  • MGC13450
  • MLC2B
  • MRLC2
  • MYL11
  • myosin light chain 2
  • myosin light chain, phosphorylatable, fast skeletal muscle
  • myosin regulatory light chain 2, skeletal muscle isoform
  • myosin, light chain 11, regulatory

Background

MYLPF( AAH12571, 1 a.a. - 170 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30249
Species: Hu, Mu, Xp
Applications: ELISA, Flow, ICC/IF, IHC, WB
NBP3-33577
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-54719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81555
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP2-03891
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-67486
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-62682
Species: Hu
Applications: IHC,  IHC-P
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
AF2444
Species: Hu
Applications: IHC, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3366
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-55151
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00085366-M01
Species: Hu, Mu
Applications: ELISA, KD, WB

Publications for Fast skeletal myosin light chain 2 Recombinant Protein Antigen (NBP2-62625PEP) (0)

There are no publications for Fast skeletal myosin light chain 2 Recombinant Protein Antigen (NBP2-62625PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fast skeletal myosin light chain 2 Recombinant Protein Antigen (NBP2-62625PEP) (0)

There are no reviews for Fast skeletal myosin light chain 2 Recombinant Protein Antigen (NBP2-62625PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fast skeletal myosin light chain 2 Recombinant Protein Antigen (NBP2-62625PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fast skeletal myosin light chain 2 Products

Blogs on Fast skeletal myosin light chain 2

There are no specific blogs for Fast skeletal myosin light chain 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fast skeletal myosin light chain 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL11