FANCI Recombinant Protein Antigen

Images

 
There are currently no images for FANCI Recombinant Protein Antigen (NBP2-55040PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FANCI Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FANCI.

Source: E. coli

Amino Acid Sequence: YYLQVCQSSGGIPKNMEKLVKLSGSHLTPLCYSFISYVQNKSKSLNYTGEKKEKPAAVATAMARVLRETKPIPNLIFAIEQYEKFLIHLSKKSKVNLMQHMKLSTSRDFKIKGN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FANCI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55040.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FANCI Recombinant Protein Antigen

  • Fanconi anemia group I protein
  • Fanconi anemia, complementation group I
  • KIAA1794FLJ10719
  • Protein FACI

Background

FANCI is the gene underlying Fanconi anemia complementation group I, a syndrome characterized by a predisposition to cancer, congenital malformations, and pancytopenia. At the cellular level, FANCI is involved in the S and G2 phase DNA damage checkpoint and in the repair of DNA double-strand breaks and cross-links.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-31883
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PLA, Simple Western, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP1-84758
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50418
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-2564
Species: Hu
Applications: WB
NB100-60439
Species: Hu, Mu
Applications: IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-89929
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2566
Species: Hu
Applications: IB, WB
H00002176-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-42677
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
MAB7745
Species: Hu
Applications: IHC, KO, Simple Western, WB

Publications for FANCI Recombinant Protein Antigen (NBP2-55040PEP) (0)

There are no publications for FANCI Recombinant Protein Antigen (NBP2-55040PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCI Recombinant Protein Antigen (NBP2-55040PEP) (0)

There are no reviews for FANCI Recombinant Protein Antigen (NBP2-55040PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FANCI Recombinant Protein Antigen (NBP2-55040PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FANCI Products

Array NBP2-55040PEP

Research Areas for FANCI Recombinant Protein Antigen (NBP2-55040PEP)

Find related products by research area.

Blogs on FANCI.

FANCD2 and DNA damage repair
Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t...  Read full blog post.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FANCI Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCI