FAM83H Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: FAM83H Antibody [NBP1-93738] - Staining in human esophagus and skeletal muscle tissues using anti-FAM83H antibody. Corresponding FAM83H RNA-seq data are ...read more
Immunohistochemistry-Paraffin: FAM83H Antibody [NBP1-93738] - Staining of human vagina shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: FAM83H Antibody [NBP1-93738] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: FAM83H Antibody [NBP1-93738] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FAM83H Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVSQAWREEVAAPGAVGGERRSLESCLLDLRDSFAQQLHQEAERQPGAASLTAAQLLDTLGRSGSDRLPSRFLSAQSHSTSPQGLDSPLPLEGS
Specificity
Specificity of human FAM83H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM83H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM83H Protein (NBP1-93738PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM83H Antibody

  • family with sequence similarity 83, member H
  • protein FAM83H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
MAB1142
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-62322
Species: Hu
Applications: WB
H00000265-M03
Species: Hu
Applications: WB, ELISA, S-ELISA
AF3026
Species: Mu
Applications: WB
NBP2-31676
Species: Hu
Applications: IHC, IHC-P
NBP1-87446
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-85500
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
H00005355-P01
Species: Hu
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89330
Species: Hu
Applications: IHC, IHC-P

Publications for FAM83H Antibody (NBP1-93738) (0)

There are no publications for FAM83H Antibody (NBP1-93738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM83H Antibody (NBP1-93738) (0)

There are no reviews for FAM83H Antibody (NBP1-93738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM83H Antibody (NBP1-93738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM83H Products

Bioinformatics Tool for FAM83H Antibody (NBP1-93738)

Discover related pathways, diseases and genes to FAM83H Antibody (NBP1-93738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM83H Antibody (NBP1-93738)

Discover more about diseases related to FAM83H Antibody (NBP1-93738).
 

Pathways for FAM83H Antibody (NBP1-93738)

View related products by pathway.

Blogs on FAM83H

There are no specific blogs for FAM83H, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM83H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM83H