FAM120B Antibody - BSA Free

Immunohistochemistry-Paraffin: FAM120B Antibody [NBP1-86567] - Staining of human kidney shows cytoplasmic and membranous positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM120B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM120B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FAM120B Protein (NBP1-86567PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FAM120B Antibody - BSA Free

• CCPGKIAA0183
• Constitutive coactivator of PPARG
• Constitutive coactivator of PPAR-gamma
• family with sequence similarity 120B
• FLJ55614
• KIAA1838constitutive coactivator of peroxisome proliferator-activated receptor gamma
• PGCC1dJ894D12.1
• PPARG constitutive coactivator 1
• PPARgamma constitutive coactivator 1
• Protein FAM120B

Background

FAM120B functions as a transactivator of PPARG and ESR1. Functions in adipogenesis through PPARG activation (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM120B