FAM107A Antibody - BSA Free

Images

 
Western Blot: FAM107A Antibody [NBP2-87397] - Host: Rabbit. Target Name: FAM107A. Sample Type: large intestine Tumor lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

FAM107A Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit FAM107A Antibody - BSA Free (NBP2-87397) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM107A. Peptide sequence: IQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
FAM107A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for FAM107A Antibody - BSA Free

  • downregulated in renal cell carcinoma
  • DRR1family with sequence similarity 107 member A transcript
  • family with sequence similarity 107, member A
  • FLJ30158
  • FLJ45473
  • Protein TU3A
  • TU3ADown-regulated in renal cell carcinoma 1

Background

FAM107A (Family With Sequence Similarity 107, Member A) is thought to have a role in tumor suppression. FAM107A is known to have interactions with CCDC85B, KRT15, NINL, TRIM37 and EFEMP2. FAM107A has been studied in relation to renal cell carcinoma, rheumatoid arthritis, meningioma, neuroblastoma and several other diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55678
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-90174
Species: Hu
Applications: IHC,  IHC-P
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF2396
Species: Hu
Applications: IHC, Simple Western, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NBP2-02651
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88535
Species: Hu
Applications: ICC/IF, WB
NBP2-42526
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP2-48656
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP2-24503
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-46421
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP3-45311
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB

Publications for FAM107A Antibody (NBP2-87397) (0)

There are no publications for FAM107A Antibody (NBP2-87397).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM107A Antibody (NBP2-87397) (0)

There are no reviews for FAM107A Antibody (NBP2-87397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM107A Antibody (NBP2-87397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM107A Products

Research Areas for FAM107A Antibody (NBP2-87397)

Find related products by research area.

Blogs on FAM107A

There are no specific blogs for FAM107A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM107A Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM107A