FAM107A Antibody - Azide and BSA Free

Western Blot: FAM107A Antibody [H00011170-B01P] - Analysis of FAM107A expression in transfected 293T cell line by FAM107A polyclonal antibody. Lane 1: FAM107A transfected lysate(15.84 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FAM107A Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse FAM107A Antibody - Azide and BSA Free (H00011170-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FAM107A (NP_009108.1, 1 a.a. - 144 a.a.) full-length human protein. MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL
• Specificity: FAM107A - family with sequence similarity 107, member A,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: FAM107A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FAM107A Antibody - Azide and BSA Free

• downregulated in renal cell carcinoma
• DRR1family with sequence similarity 107 member A transcript
• family with sequence similarity 107, member A
• FLJ30158
• FLJ45473
• Protein TU3A
• TU3ADown-regulated in renal cell carcinoma 1

Background

FAM107A (Family With Sequence Similarity 107, Member A) is thought to have a role in tumor suppression. FAM107A is known to have interactions with CCDC85B, KRT15, NINL, TRIM37 and EFEMP2. FAM107A has been studied in relation to renal cell carcinoma, rheumatoid arthritis, meningioma, neuroblastoma and several other diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM107A
• Entrez:
  • 11170(Human)
• Uniprot:
  • NP_009108.1(Human)