FAIM2 Antibody - BSA Free

Western Blot: FAIM2 Antibody [NBP3-04403] - Analysis of extracts of mouse brain, using FAIM2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit .

Product Discontinued

FAIM2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human FAIM2 (NP_036438.2). MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAIM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FAIM2 Antibody - BSA Free

• Fas apoptotic inhibitory molecule 2
• KIAA0950NGP35
• LFG2
• LFGLIFEGUARD
• NMP35neural membrane protein 35
• Protein lifeguard
• TMBIM2lifeguard
• transmembrane BAX inhibitor motif containing 2
• Transmembrane BAX inhibitor motif-containing protein 2

Background

Protects cells uniquely from Fas-induced apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAIM2