Factor VIII Recombinant Protein

Product Details

Summary
Reactivity Hu
Applications WB, ELISA, PA
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.

Factor VIII Recombinant Protein Summary

Description
Factor VIII (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Modification
No Modifications
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
F8

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Protein Array
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Factor VIII Recombinant Protein

  • AHF
  • Antihemophilic factor
  • coagulation factor VIII, procoagulant component
  • coagulation factor VIIIc
  • DXS1253E
  • F8Ccoagulation factor VIII
  • factor VIII F8B
  • FVIII
  • HEMAF8B
  • Procoagulant component

Background

This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
Applications: WB, ELISA, PA
AF6796
Species: Hu
Applications: WB, ICC
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2338
Species: Hu
Applications: WB, IP, ICC
NBP1-33581
Species: Hu, Rt
Applications: IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC
NBL1-11228
Applications: WB
MAB7445
Species: Hu
Applications: WB
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: IHC, IHC-P
BAF1936
Species: Hu
Applications: WB
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for Factor VIII Recombinant Protein (H00002157-P01) (0)

There are no publications for Factor VIII Recombinant Protein (H00002157-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor VIII Recombinant Protein (H00002157-P01) (0)

There are no reviews for Factor VIII Recombinant Protein (H00002157-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Factor VIII Recombinant Protein (H00002157-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Factor VIII Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for Factor VIII Recombinant Protein (H00002157-P01)

Discover related pathways, diseases and genes to Factor VIII Recombinant Protein (H00002157-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor VIII Recombinant Protein (H00002157-P01)

Discover more about diseases related to Factor VIII Recombinant Protein (H00002157-P01).
 

Pathways for Factor VIII Recombinant Protein (H00002157-P01)

View related products by pathway.

PTMs for Factor VIII Recombinant Protein (H00002157-P01)

Learn more about PTMs related to Factor VIII Recombinant Protein (H00002157-P01).

Blogs on Factor VIII.

Factor VIII - a key factor in the clotting process
Hemostasis, or blood clotting, follows tissue injury and involves the deployment of essential plasma procoagulants (such as prothrombin, and Factors X, IX, V, and VIII) that trigger the blood coagulation cascade. This cascade leads to the formation...  Read full blog post.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol F8

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00002157-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532