Recombinant Human Factor VIII Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Factor VIII Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 213-312 of Human Factor VIII

Source: Wheat Germ

Amino Acid Sequence: KFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
F8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Factor VIII Protein

  • AHF
  • Antihemophilic factor
  • coagulation factor VIII, procoagulant component
  • coagulation factor VIIIc
  • DXS1253E
  • F8Ccoagulation factor VIII
  • factor VIII F8B
  • FVIII
  • HEMAF8B
  • Procoagulant component

Background

F8 - coagulation factor VIII, procoagulant component (hemophilia A)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2338
Species: Hu
Applications: WB, IP, ICC
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-36777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Factor VIII Partial Recombinant Protein (H00002157-Q01) (0)

There are no publications for Factor VIII Partial Recombinant Protein (H00002157-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor VIII Partial Recombinant Protein (H00002157-Q01) (0)

There are no reviews for Factor VIII Partial Recombinant Protein (H00002157-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Factor VIII Partial Recombinant Protein (H00002157-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Factor VIII Products

Bioinformatics Tool for Factor VIII Partial Recombinant Protein (H00002157-Q01)

Discover related pathways, diseases and genes to Factor VIII Partial Recombinant Protein (H00002157-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor VIII Partial Recombinant Protein (H00002157-Q01)

Discover more about diseases related to Factor VIII Partial Recombinant Protein (H00002157-Q01).
 

Pathways for Factor VIII Partial Recombinant Protein (H00002157-Q01)

View related products by pathway.

PTMs for Factor VIII Partial Recombinant Protein (H00002157-Q01)

Learn more about PTMs related to Factor VIII Partial Recombinant Protein (H00002157-Q01).

Blogs on Factor VIII.

Factor VIII - a key factor in the clotting process
Hemostasis, or blood clotting, follows tissue injury and involves the deployment of essential plasma procoagulants (such as prothrombin, and Factors X, IX, V, and VIII) that trigger the blood coagulation cascade. This cascade leads to the formation...  Read full blog post.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Factor VIII Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol F8