Factor VIII Antibody (1E8.)

Images

 
Proximity Ligation Assay: Factor VIII Antibody (1E8) [H00002157-M03] - Analysis of protein-protein interactions between CALR and Factor VIII. HeLa cells were stained with anti-CALR rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: Factor VIII Antibody (1E8) [H00002157-M03] - Detection limit for recombinant GST tagged F8 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, PLA
Clone
1E8.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Factor VIII Antibody (1E8.) Summary

Immunogen
F8 (NP_000123 213 a.a. - 312 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITF
Specificity
F8 (1E8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
F8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Factor VIII Antibody (1E8.)

  • AHF
  • Antihemophilic factor
  • coagulation factor VIII, procoagulant component
  • coagulation factor VIIIc
  • DXS1253E
  • F8Ccoagulation factor VIII
  • factor VIII F8B
  • FVIII
  • HEMAF8B
  • Procoagulant component

Background

This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2338
Species: Hu
Applications: WB, IP, ICC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00002157-M03
Species: Hu
Applications: ELISA, PLA

Publications for Factor VIII Antibody (H00002157-M03) (0)

There are no publications for Factor VIII Antibody (H00002157-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor VIII Antibody (H00002157-M03) (0)

There are no reviews for Factor VIII Antibody (H00002157-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Factor VIII Antibody (H00002157-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Factor VIII Products

Bioinformatics Tool for Factor VIII Antibody (H00002157-M03)

Discover related pathways, diseases and genes to Factor VIII Antibody (H00002157-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor VIII Antibody (H00002157-M03)

Discover more about diseases related to Factor VIII Antibody (H00002157-M03).
 

Pathways for Factor VIII Antibody (H00002157-M03)

View related products by pathway.

PTMs for Factor VIII Antibody (H00002157-M03)

Learn more about PTMs related to Factor VIII Antibody (H00002157-M03).

Blogs on Factor VIII.

Factor VIII - a key factor in the clotting process
Hemostasis, or blood clotting, follows tissue injury and involves the deployment of essential plasma procoagulants (such as prothrombin, and Factors X, IX, V, and VIII) that trigger the blood coagulation cascade. This cascade leads to the formation...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Factor VIII Antibody (1E8.) and receive a gift card or discount.

Bioinformatics

Gene Symbol F8
Entrez
OMIM
Uniprot