F box protein 38 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: F box protein 38 Antibody [NBP1-87932] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: F box protein 38 Antibody [NBP1-87932] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

F box protein 38 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQMKKGVFQRVVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO38
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
F box protein 38 Protein (NBP1-87932PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for F box protein 38 Antibody

  • F-box only protein 38
  • F-box protein 38
  • FBX38
  • FLJ13962
  • Modulator of KLF7 activity homolog
  • MoKA
  • MOKAFbx38
  • SP329

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-80638
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4838
Species: Hu
Applications: WB, Simple Western
NBP1-84987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3626
Species: Mu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF5596
Species: Hu
Applications: WB, IHC, ICC
H00115426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-93620
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
H00056996-R01
Species: Hu
NBP1-87932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for F box protein 38 Antibody (NBP1-87932) (0)

There are no publications for F box protein 38 Antibody (NBP1-87932).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for F box protein 38 Antibody (NBP1-87932) (0)

There are no reviews for F box protein 38 Antibody (NBP1-87932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for F box protein 38 Antibody (NBP1-87932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional F box protein 38 Products

Bioinformatics Tool for F box protein 38 Antibody (NBP1-87932)

Discover related pathways, diseases and genes to F box protein 38 Antibody (NBP1-87932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for F box protein 38 Antibody (NBP1-87932)

Discover more about diseases related to F box protein 38 Antibody (NBP1-87932).

Blogs on F box protein 38

There are no specific blogs for F box protein 38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our F box protein 38 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO38