F box protein 38 Antibody

Immunocytochemistry/Immunofluorescence: F box protein 38 Antibody [NBP1-87932] - Staining of human cell line A-431 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: F box protein 38 Antibody [NBP1-87932] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

F box protein 38 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQMKKGVFQRVVA
• Predicted Species: Mouse (96%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXO38
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  F box protein 38 Protein (NBP1-87932PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for F box protein 38 Antibody

• F-box only protein 38
• F-box protein 38
• FBX38
• FLJ13962
• Modulator of KLF7 activity homolog
• MoKA
• MOKAFbx38
• SP329

Background

Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination anddegradation. May coactivate KLF7, but does not seem to promote KLF7 ubiquitination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXO38