Exosome component 4 Antibody (4F9)

Images

 
Western Blot: Exosome component 4 Antibody (4F9) [H00054512-M02] - Analysis of EXOSC4 expression in transfected 293T cell line by EXOSC4 monoclonal antibody (M02), clone 4F9.Lane 1: EXOSC4 transfected lysate(26.4 ...read more
Sandwich ELISA: Exosome component 4 Antibody (4F9) [H00054512-M02] - Detection limit for recombinant GST tagged EXOSC4 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Exosome component 4 Antibody (4F9) Summary

Immunogen
EXOSC4 (NP_061910.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG
Specificity
EXOSC4 - exosome component 4 (4F9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EXOSC4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Exosome component 4 Antibody (4F9)

  • exosome complex exonuclease RRP41
  • exosome component 4Rrp41p
  • exosome component Rrp41
  • FLJ20591
  • p12ARibosomal RNA-processing protein 41
  • RRP41A
  • RRP41Ski6p
  • SKI6hRrp41p

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-97759
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-85092
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-50173
Species: Hu
Applications: ELISA, Flow, IHC, WB
NBP2-47274
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01732
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00022894-B01P
Species: Ch, Hu, Mu
Applications: ICC/IF, WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP3-10064
Species: Hu
Applications: WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-82485
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-82018
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-57508
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-16109
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00054512-M02
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for Exosome component 4 Antibody (H00054512-M02) (0)

There are no publications for Exosome component 4 Antibody (H00054512-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exosome component 4 Antibody (H00054512-M02) (0)

There are no reviews for Exosome component 4 Antibody (H00054512-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exosome component 4 Antibody (H00054512-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Exosome component 4 Products

Bioinformatics Tool for Exosome component 4 Antibody (H00054512-M02)

Discover related pathways, diseases and genes to Exosome component 4 Antibody (H00054512-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exosome component 4 Antibody (H00054512-M02)

Discover more about diseases related to Exosome component 4 Antibody (H00054512-M02).
 

Pathways for Exosome component 4 Antibody (H00054512-M02)

View related products by pathway.

Blogs on Exosome component 4

There are no specific blogs for Exosome component 4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exosome component 4 Antibody (4F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOSC4
Entrez
Uniprot