Exosome component 10 Antibody (1E6.)

Images

 
ELISA: Exosome component 10 Antibody (1E6.) [H00005394-M08] - Exosome component 10 Antibody (1E6) [H00005394-M08] - Detection limit for recombinant GST tagged EXOSC10 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Exosome component 10 Antibody (1E6.) Summary

Immunogen
EXOSC10 (NP_001001998.1, 1 a.a. - 99 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKD
Specificity
EXOSC10 - exosome component 10 (1E6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EXOSC10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00005394-M08.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Exosome component 10 Antibody (1E6.)

  • autoantigen PM-SCL
  • EC 3.1.13.-
  • exosome component 10
  • P100 polymyositis-scleroderma overlap syndrome-associated autoantigen
  • p2
  • p3
  • p4
  • PM/Scl-100Autoantigen PM/Scl 2
  • PM-Scl
  • PMSCL2PMSCL
  • polymyositis/scleroderma autoantigen 2 (100kD)
  • Polymyositis/scleroderma autoantigen 2
  • polymyositis/scleroderma autoantigen 2, 100kDa
  • RRP6
  • Rrp6p
  • RRP6Polymyositis/scleroderma autoantigen 100 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Exosome component 10 Antibody (H00005394-M08)(1)

Reviews for Exosome component 10 Antibody (H00005394-M08) (0)

There are no reviews for Exosome component 10 Antibody (H00005394-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exosome component 10 Antibody (H00005394-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Exosome component 10 Products

Bioinformatics Tool for Exosome component 10 Antibody (H00005394-M08)

Discover related pathways, diseases and genes to Exosome component 10 Antibody (H00005394-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exosome component 10 Antibody (H00005394-M08)

Discover more about diseases related to Exosome component 10 Antibody (H00005394-M08).
 

Pathways for Exosome component 10 Antibody (H00005394-M08)

View related products by pathway.

PTMs for Exosome component 10 Antibody (H00005394-M08)

Learn more about PTMs related to Exosome component 10 Antibody (H00005394-M08).

Blogs on Exosome component 10

There are no specific blogs for Exosome component 10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exosome component 10 Antibody (1E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOSC10
Entrez
Uniprot