EXOC6B Antibody

Images

 
Western Blot: EXOC6B Antibody [NBP2-56692] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: EXOC6B Antibody [NBP2-56692] - Staining of human cell line RT4 shows localization to nucleoplasm, nuclear bodies & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EXOC6B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKQAQQQRNLDNIVLQQPRIGSKRKSKKDAYIIFDTEIESTSPKSEQDSGILDVEDEE
Specificity
Specificity of human EXOC6B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXOC6B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EXOC6B Recombinant Protein Antigen (NBP2-56692PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EXOC6B Antibody

  • exocyst complex component 6B
  • SEC15B
  • SEC15L2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85031
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, Gp, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-97500
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha, Pm, Rb, Sh, Ye
Applications: WB, IB, ICC/IF, IHC, IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP2-99472
Species: Hu
Applications: IHC, IHC-P
NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00010928-M02
Species: Hu, Xp
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP1-86344
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004218-M02
Species: Hu, Mu, Ze
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-84767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87174
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-56692
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for EXOC6B Antibody (NBP2-56692) (0)

There are no publications for EXOC6B Antibody (NBP2-56692).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EXOC6B Antibody (NBP2-56692) (0)

There are no reviews for EXOC6B Antibody (NBP2-56692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EXOC6B Antibody (NBP2-56692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EXOC6B Products

Bioinformatics Tool for EXOC6B Antibody (NBP2-56692)

Discover related pathways, diseases and genes to EXOC6B Antibody (NBP2-56692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EXOC6B Antibody (NBP2-56692)

Discover more about diseases related to EXOC6B Antibody (NBP2-56692).
 

Pathways for EXOC6B Antibody (NBP2-56692)

View related products by pathway.

Blogs on EXOC6B

There are no specific blogs for EXOC6B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EXOC6B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOC6B