EXOC6B Antibody

Images

 
Immunohistochemistry-Paraffin: EXOC6B Antibody [NBP2-31869] - Staining of human stomach shows moderate nucleolar and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EXOC6B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TNLNQKIDQFLQLADYDWMTGDLGNKASDYLVDLIAFLRSTFAVFTHLPVSGSCYFVLYI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXOC6B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EXOC6B Protein (NBP2-31869PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EXOC6B Antibody

  • exocyst complex component 6B
  • SEC15B
  • SEC15L2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85031
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89957
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-97500
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha, Mk, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP2-31841
Species: Hu
Applications: IHC, IHC-P
NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-84767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
NBP2-31869
Species: Hu
Applications: IHC, IHC-P

Publications for EXOC6B Antibody (NBP2-31869) (0)

There are no publications for EXOC6B Antibody (NBP2-31869).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EXOC6B Antibody (NBP2-31869) (0)

There are no reviews for EXOC6B Antibody (NBP2-31869). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EXOC6B Antibody (NBP2-31869) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EXOC6B Products

Bioinformatics Tool for EXOC6B Antibody (NBP2-31869)

Discover related pathways, diseases and genes to EXOC6B Antibody (NBP2-31869). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EXOC6B Antibody (NBP2-31869)

Discover more about diseases related to EXOC6B Antibody (NBP2-31869).
 

Pathways for EXOC6B Antibody (NBP2-31869)

View related products by pathway.

Blogs on EXOC6B

There are no specific blogs for EXOC6B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EXOC6B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOC6B
Uniprot