EVORF Antibody

Images

 
Western Blot: EVORF Antibody [NBP2-84874] - WB Suggested Anti-C16orf80 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Placenta

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gt, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EVORF Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EVORF. Peptide sequence: AYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAK The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Goat (93%), Canine (100%), Equine (100%), Zebrafish (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
C16orf80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EVORF Antibody

  • C16orf80
  • chromosome 16 open reading frame 80
  • fSAP23
  • GTL3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66778
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-01265
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-92637
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-67731
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55408
Species: Hu
Applications: WB, ICC/IF
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-16760
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55335
Species: Hu
Applications: WB, ICC/IF
H00006879-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO

Publications for EVORF Antibody (NBP2-84874) (0)

There are no publications for EVORF Antibody (NBP2-84874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EVORF Antibody (NBP2-84874) (0)

There are no reviews for EVORF Antibody (NBP2-84874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EVORF Antibody (NBP2-84874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EVORF Products

Array NBP2-84874

Bioinformatics Tool for EVORF Antibody (NBP2-84874)

Discover related pathways, diseases and genes to EVORF Antibody (NBP2-84874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on EVORF

There are no specific blogs for EVORF, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EVORF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C16orf80